Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   KH277_RS07750 Genome accession   NZ_CP075054
Coordinates   1497930..1498103 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain VTX20     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1492930..1503103
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KH277_RS07700 (KH277_07700) comGD 1493051..1493488 (+) 438 WP_014305413.1 competence type IV pilus minor pilin ComGD Machinery gene
  KH277_RS07705 (KH277_07705) comGE 1493472..1493786 (+) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  KH277_RS07710 (KH277_07710) comGF 1493800..1494195 (+) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  KH277_RS07715 (KH277_07715) comGG 1494196..1494573 (+) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  KH277_RS07720 (KH277_07720) - 1494630..1494809 (+) 180 WP_003153093.1 YqzE family protein -
  KH277_RS07725 (KH277_07725) - 1494849..1495178 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  KH277_RS07730 (KH277_07730) tapA 1495437..1496108 (+) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  KH277_RS07735 (KH277_07735) - 1496080..1496664 (+) 585 WP_012117977.1 signal peptidase I -
  KH277_RS07740 (KH277_07740) - 1496728..1497513 (+) 786 WP_003153102.1 TasA family protein -
  KH277_RS07745 (KH277_07745) sinR 1497561..1497896 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KH277_RS07750 (KH277_07750) sinI 1497930..1498103 (-) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  KH277_RS07755 (KH277_07755) - 1498280..1499074 (-) 795 WP_014305407.1 YqhG family protein -
  KH277_RS07760 (KH277_07760) - 1499092..1500762 (-) 1671 WP_213390996.1 SNF2-related protein -
  KH277_RS07765 (KH277_07765) gcvT 1501186..1502286 (+) 1101 WP_058906182.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=567474 KH277_RS07750 WP_003153105.1 1497930..1498103(-) (sinI) [Bacillus velezensis strain VTX20]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=567474 KH277_RS07750 WP_003153105.1 1497930..1498103(-) (sinI) [Bacillus velezensis strain VTX20]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGTCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702