Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   KIV12_RS06895 Genome accession   NZ_CP075052
Coordinates   1410083..1410223 (+) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus altitudinis strain LZP 02     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1405083..1415223
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KIV12_RS06870 (KIV12_06870) - 1405314..1405721 (+) 408 WP_007500468.1 YueI family protein -
  KIV12_RS06875 (KIV12_06875) - 1405782..1406333 (+) 552 WP_008345872.1 cysteine hydrolase family protein -
  KIV12_RS06880 (KIV12_06880) - 1406411..1407820 (+) 1410 WP_235701801.1 nicotinate phosphoribosyltransferase -
  KIV12_RS06885 (KIV12_06885) - 1407961..1409187 (+) 1227 WP_035701209.1 EAL and HDOD domain-containing protein -
  KIV12_RS06890 (KIV12_06890) - 1409224..1409577 (-) 354 WP_017367963.1 hypothetical protein -
  KIV12_RS06895 (KIV12_06895) degQ 1410083..1410223 (+) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  KIV12_RS06900 (KIV12_06900) - 1410375..1411298 (+) 924 WP_217967871.1 polyprenyl synthetase family protein -
  KIV12_RS06905 (KIV12_06905) comX 1411276..1411449 (+) 174 WP_135009732.1 competence pheromone ComX -
  KIV12_RS06910 (KIV12_06910) comP 1411463..1413754 (+) 2292 WP_135009734.1 ATP-binding protein Regulator
  KIV12_RS06915 (KIV12_06915) comA 1413835..1414476 (+) 642 WP_007500477.1 response regulator transcription factor Regulator
  KIV12_RS06920 (KIV12_06920) - 1414500..1414889 (+) 390 WP_017358943.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=567395 KIV12_RS06895 WP_003213123.1 1410083..1410223(+) (degQ) [Bacillus altitudinis strain LZP 02]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=567395 KIV12_RS06895 WP_003213123.1 1410083..1410223(+) (degQ) [Bacillus altitudinis strain LZP 02]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACAGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696