Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   LILO_RS08290 Genome accession   NC_020450
Coordinates   1748160..1748732 (-) Length   190 a.a.
NCBI ID   WP_015426819.1    Uniprot ID   -
Organism   Lactococcus lactis subsp. lactis IO-1     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1716917..1759783 1748160..1748732 within 0


Gene organization within MGE regions


Location: 1716917..1759783
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LILO_RS08070 (lilo_1561) - 1716917..1717117 (-) 201 WP_014570681.1 cold-shock protein -
  LILO_RS12115 - 1718320..1718463 (-) 144 WP_170275335.1 hypothetical protein -
  LILO_RS08075 (lilo_1562) - 1718538..1719419 (-) 882 WP_042230494.1 hypothetical protein -
  LILO_RS08080 (lilo_1564) arsC 1719790..1720194 (-) 405 WP_015426784.1 arsenate reductase (thioredoxin) -
  LILO_RS08085 (lilo_1565) - 1720287..1721627 (-) 1341 WP_015426785.1 LysM peptidoglycan-binding domain-containing protein -
  LILO_RS08090 - 1721624..1721848 (-) 225 WP_042230496.1 phage holin -
  LILO_RS08095 (lilo_1566) - 1721862..1722083 (-) 222 WP_012897995.1 hemolysin XhlA family protein -
  LILO_RS11970 (lilo_1567) - 1722101..1723174 (-) 1074 WP_015426786.1 hypothetical protein -
  LILO_RS12120 - 1723174..1723311 (-) 138 WP_162838863.1 hypothetical protein -
  LILO_RS08110 (lilo_1568) - 1723308..1725845 (-) 2538 WP_015426787.1 gp58-like family protein -
  LILO_RS08115 (lilo_1569) - 1725857..1726222 (-) 366 WP_015426788.1 DUF6711 family protein -
  LILO_RS08120 (lilo_1570) - 1726234..1731015 (-) 4782 WP_042230499.1 tail protein -
  LILO_RS08125 (lilo_1571) - 1731047..1731418 (-) 372 WP_015426790.1 hypothetical protein -
  LILO_RS08130 (lilo_1572) - 1731442..1731852 (-) 411 WP_015426791.1 DUF6096 family protein -
  LILO_RS08135 (lilo_1573) - 1731926..1732357 (-) 432 WP_015426792.1 phage tail tube protein -
  LILO_RS08140 (lilo_1574) - 1732370..1732732 (-) 363 WP_015426793.1 hypothetical protein -
  LILO_RS08145 (lilo_1575) - 1732732..1733280 (-) 549 WP_015426794.1 hypothetical protein -
  LILO_RS08150 (lilo_1576) - 1733264..1733611 (-) 348 WP_015426795.1 hypothetical protein -
  LILO_RS08155 (lilo_1577) - 1733592..1733924 (-) 333 WP_015426796.1 phage head-tail connector protein -
  LILO_RS08160 (lilo_1578) - 1733945..1735063 (-) 1119 WP_015426797.1 Ig-like domain-containing protein -
  LILO_RS08165 (lilo_1579) - 1735075..1735731 (-) 657 WP_015426798.1 DUF4355 domain-containing protein -
  LILO_RS08170 (lilo_1580) - 1735896..1737002 (-) 1107 WP_015426799.1 minor capsid protein -
  LILO_RS08175 (lilo_1581) - 1737007..1737294 (-) 288 WP_015426800.1 ribosomal-processing cysteine protease Prp -
  LILO_RS12125 - 1737291..1737455 (-) 165 WP_170275344.1 hypothetical protein -
  LILO_RS08180 (lilo_1582) - 1737412..1738920 (-) 1509 WP_015426801.1 phage portal protein -
  LILO_RS08185 (lilo_1583) - 1738930..1740219 (-) 1290 WP_371866391.1 PBSX family phage terminase large subunit -
  LILO_RS08190 - 1740206..1740658 (-) 453 WP_042230504.1 terminase small subunit -
  LILO_RS08200 (lilo_1584) - 1740944..1741366 (-) 423 WP_014024904.1 RinA family protein -
  LILO_RS08205 (lilo_1589) - 1742297..1742506 (+) 210 WP_015426807.1 hypothetical protein -
  LILO_RS12130 - 1742555..1742710 (-) 156 WP_042230506.1 hypothetical protein -
  LILO_RS08215 - 1742707..1742889 (-) 183 WP_042230508.1 hypothetical protein -
  LILO_RS08220 (lilo_1591) - 1742886..1743185 (-) 300 WP_015426809.1 hypothetical protein -
  LILO_RS08225 (lilo_1592) - 1743232..1743615 (-) 384 WP_148284416.1 hypothetical protein -
  LILO_RS08230 (lilo_1593) - 1743618..1744007 (-) 390 WP_042230510.1 hypothetical protein -
  LILO_RS08235 (lilo_1594) - 1744000..1744206 (-) 207 WP_042230512.1 hypothetical protein -
  LILO_RS08240 (lilo_1595) - 1744190..1744450 (-) 261 WP_148284417.1 6-O-methylguanine DNA methyltransferase -
  LILO_RS08245 (lilo_1596) - 1744443..1744763 (-) 321 WP_015426814.1 hypothetical protein -
  LILO_RS08250 - 1744756..1744983 (-) 228 WP_042230514.1 hypothetical protein -
  LILO_RS08255 - 1744980..1745174 (-) 195 WP_042230516.1 hypothetical protein -
  LILO_RS08260 (lilo_1597) - 1745171..1745674 (-) 504 WP_080619352.1 DUF1642 domain-containing protein -
  LILO_RS08265 - 1745751..1745930 (-) 180 WP_042230518.1 hypothetical protein -
  LILO_RS08270 (lilo_1598) - 1745939..1746448 (-) 510 WP_015426816.1 hypothetical protein -
  LILO_RS08275 (lilo_1599) - 1746472..1746888 (-) 417 WP_015426817.1 hypothetical protein -
  LILO_RS08280 - 1746901..1747143 (-) 243 WP_042230520.1 hypothetical protein -
  LILO_RS08285 (lilo_1600) - 1747136..1748035 (-) 900 WP_042230522.1 DnaD domain protein -
  LILO_RS08290 (lilo_1601) ssb 1748160..1748732 (-) 573 WP_015426819.1 single-stranded DNA-binding protein Machinery gene
  LILO_RS08295 (lilo_1602) - 1748746..1749237 (-) 492 WP_015426820.1 ERF family protein -
  LILO_RS08300 (lilo_1603) - 1749246..1749641 (-) 396 WP_015426821.1 hypothetical protein -
  LILO_RS08305 (lilo_1604) - 1749743..1749979 (-) 237 WP_015426822.1 DUF1408 domain-containing protein -
  LILO_RS08310 (lilo_1605) - 1750083..1750517 (+) 435 WP_042230523.1 hypothetical protein -
  LILO_RS12035 - 1750507..1750659 (-) 153 WP_158414574.1 hypothetical protein -
  LILO_RS08315 (lilo_1606) - 1750814..1751050 (-) 237 WP_011834775.1 helix-turn-helix domain-containing protein -
  LILO_RS08320 (lilo_1607) - 1751063..1751776 (-) 714 WP_015426824.1 phage antirepressor Ant -
  LILO_RS08325 (lilo_1608) - 1751786..1752001 (-) 216 WP_015426825.1 hypothetical protein -
  LILO_RS08330 (lilo_1609) - 1752013..1752243 (-) 231 WP_042230525.1 helix-turn-helix transcriptional regulator -
  LILO_RS08335 (lilo_1610) - 1752397..1752852 (+) 456 WP_015426827.1 hypothetical protein -
  LILO_RS08340 (lilo_1611) - 1753166..1753690 (+) 525 WP_015426828.1 helix-turn-helix domain-containing protein -
  LILO_RS08345 (lilo_1612) - 1753700..1754287 (+) 588 WP_015426829.1 hypothetical protein -
  LILO_RS08350 (lilo_1613) - 1754345..1754926 (+) 582 WP_015426830.1 CD20-like domain-containing protein -
  LILO_RS08355 (lilo_1614) - 1755047..1756180 (+) 1134 WP_042230530.1 tyrosine-type recombinase/integrase -
  LILO_RS08360 (lilo_1615) - 1756375..1757349 (-) 975 WP_015426832.1 substrate-binding domain-containing protein -
  LILO_RS08365 (lilo_1616) - 1757361..1758263 (-) 903 WP_225513451.1 ABC transporter permease -
  LILO_RS08370 (lilo_1617) - 1758305..1759783 (-) 1479 WP_042230532.1 sugar ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 190 a.a.        Molecular weight: 21799.63 Da        Isoelectric Point: 6.4656

>NTDB_id=56473 LILO_RS08290 WP_015426819.1 1748160..1748732(-) (ssb) [Lactococcus lactis subsp. lactis IO-1]
MINNVVLVGRLTKDVELRYTPQNQATATFSLAVSRSFKNANGERETDFINCVIWRQQAENMANFTHKGSLIGITGRIQTR
NYENQQGQRVYVTEVVADSFQLLESRSQGQQQQQQGQYQGQQGNYNQNQNNYQNQGQQNTVPQQHNQGNYQRQPQVNYQN
QQQSAQQRAQQPDPNFGGAPMEINDEDLPF

Nucleotide


Download         Length: 573 bp        

>NTDB_id=56473 LILO_RS08290 WP_015426819.1 1748160..1748732(-) (ssb) [Lactococcus lactis subsp. lactis IO-1]
ATGATAAATAACGTAGTTTTAGTCGGAAGACTAACTAAAGATGTAGAACTTAGATATACTCCACAAAATCAAGCTACAGC
AACTTTCTCGCTTGCAGTGAGTCGCTCTTTCAAAAATGCCAATGGAGAACGTGAAACAGATTTTATTAACTGTGTTATCT
GGCGACAACAAGCTGAAAATATGGCAAATTTTACACATAAAGGAAGCTTGATTGGTATCACTGGTAGAATCCAAACTCGA
AACTATGAAAATCAACAAGGACAACGTGTTTACGTTACTGAAGTTGTTGCAGATAGTTTCCAACTTCTTGAAAGTAGAAG
CCAAGGTCAACAACAGCAACAACAAGGGCAGTATCAGGGACAACAAGGAAATTACAATCAAAACCAAAATAATTACCAAA
ATCAGGGACAACAAAATACTGTTCCACAGCAACATAACCAAGGTAACTACCAAAGACAACCTCAAGTTAATTATCAAAAT
CAACAACAATCAGCTCAACAAAGAGCCCAACAACCCGATCCAAACTTTGGAGGTGCTCCGATGGAAATCAACGATGAAGA
CCTACCATTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

56.771

100

0.574
  ssbA Bacillus subtilis subsp. subtilis str. 168

52.083

100

0.526
  ssb Glaesserella parasuis strain SC1401

35.533

100

0.368

Multiple sequence alignment