Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   KHA74_RS12715 Genome accession   NZ_CP074348
Coordinates   2625182..2625619 (-) Length   145 a.a.
NCBI ID   WP_094032243.1    Uniprot ID   -
Organism   Bacillus velezensis strain SW5     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2620182..2630619
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KHA74_RS12665 (KHA74_12575) sinI 2620566..2620739 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  KHA74_RS12670 (KHA74_12580) sinR 2620773..2621108 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KHA74_RS12675 (KHA74_12585) - 2621156..2621941 (-) 786 WP_007408329.1 TasA family protein -
  KHA74_RS12680 (KHA74_12590) - 2622006..2622590 (-) 585 WP_015240205.1 signal peptidase I -
  KHA74_RS12685 (KHA74_12595) tapA 2622562..2623233 (-) 672 WP_015417813.1 amyloid fiber anchoring/assembly protein TapA -
  KHA74_RS12690 (KHA74_12600) - 2623492..2623821 (+) 330 WP_094032245.1 DUF3889 domain-containing protein -
  KHA74_RS12695 (KHA74_12605) - 2623861..2624040 (-) 180 WP_003153093.1 YqzE family protein -
  KHA74_RS12700 (KHA74_12610) comGG 2624097..2624474 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  KHA74_RS12705 (KHA74_12615) comGF 2624475..2624975 (-) 501 WP_254922226.1 competence type IV pilus minor pilin ComGF -
  KHA74_RS12710 (KHA74_12620) comGE 2624884..2625198 (-) 315 WP_094032244.1 competence type IV pilus minor pilin ComGE -
  KHA74_RS12715 (KHA74_12625) comGD 2625182..2625619 (-) 438 WP_094032243.1 competence type IV pilus minor pilin ComGD Machinery gene
  KHA74_RS12720 (KHA74_12630) comGC 2625609..2625917 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  KHA74_RS12725 (KHA74_12635) comGB 2625922..2626959 (-) 1038 WP_015417819.1 competence type IV pilus assembly protein ComGB Machinery gene
  KHA74_RS12730 (KHA74_12640) comGA 2626946..2628016 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  KHA74_RS12735 (KHA74_12645) - 2628209..2629159 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -
  KHA74_RS12740 (KHA74_12650) - 2629305..2630606 (+) 1302 WP_012117986.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16254.72 Da        Isoelectric Point: 10.2172

>NTDB_id=564076 KHA74_RS12715 WP_094032243.1 2625182..2625619(-) (comGD) [Bacillus velezensis strain SW5]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPACTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHRYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=564076 KHA74_RS12715 WP_094032243.1 2625182..2625619(-) (comGD) [Bacillus velezensis strain SW5]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACAGTTTTGTTCACGACGGTTCCGCCGGCCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAGATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATCCAATTGAAGAGTGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.164

100

0.566