Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   KHA74_RS12665 Genome accession   NZ_CP074348
Coordinates   2620566..2620739 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain SW5     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2615566..2625739
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KHA74_RS12650 (KHA74_12560) gcvT 2616379..2617479 (-) 1101 WP_025284994.1 glycine cleavage system aminomethyltransferase GcvT -
  KHA74_RS12655 (KHA74_12565) - 2617903..2619573 (+) 1671 WP_031378948.1 SNF2-related protein -
  KHA74_RS12660 (KHA74_12570) - 2619595..2620389 (+) 795 WP_007408330.1 YqhG family protein -
  KHA74_RS12665 (KHA74_12575) sinI 2620566..2620739 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  KHA74_RS12670 (KHA74_12580) sinR 2620773..2621108 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KHA74_RS12675 (KHA74_12585) - 2621156..2621941 (-) 786 WP_007408329.1 TasA family protein -
  KHA74_RS12680 (KHA74_12590) - 2622006..2622590 (-) 585 WP_015240205.1 signal peptidase I -
  KHA74_RS12685 (KHA74_12595) tapA 2622562..2623233 (-) 672 WP_015417813.1 amyloid fiber anchoring/assembly protein TapA -
  KHA74_RS12690 (KHA74_12600) - 2623492..2623821 (+) 330 WP_094032245.1 DUF3889 domain-containing protein -
  KHA74_RS12695 (KHA74_12605) - 2623861..2624040 (-) 180 WP_003153093.1 YqzE family protein -
  KHA74_RS12700 (KHA74_12610) comGG 2624097..2624474 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  KHA74_RS12705 (KHA74_12615) comGF 2624475..2624975 (-) 501 WP_254922226.1 competence type IV pilus minor pilin ComGF -
  KHA74_RS12710 (KHA74_12620) comGE 2624884..2625198 (-) 315 WP_094032244.1 competence type IV pilus minor pilin ComGE -
  KHA74_RS12715 (KHA74_12625) comGD 2625182..2625619 (-) 438 WP_094032243.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=564073 KHA74_RS12665 WP_003153105.1 2620566..2620739(+) (sinI) [Bacillus velezensis strain SW5]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=564073 KHA74_RS12665 WP_003153105.1 2620566..2620739(+) (sinI) [Bacillus velezensis strain SW5]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702