Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   KFV11_RS08575 Genome accession   NZ_CP073809
Coordinates   1649480..1649974 (-) Length   164 a.a.
NCBI ID   WP_254249734.1    Uniprot ID   -
Organism   Macrococcus equipercicus strain Epi0143-OL     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1617685..1674665 1649480..1649974 within 0


Gene organization within MGE regions


Location: 1617685..1674665
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KFV11_RS08380 (KFV11_08395) - 1617685..1618329 (-) 645 WP_254249697.1 hypothetical protein -
  KFV11_RS08385 (KFV11_08400) - 1618506..1618769 (-) 264 WP_254249698.1 hypothetical protein -
  KFV11_RS08390 (KFV11_08405) - 1618863..1619498 (-) 636 WP_254249699.1 PIN domain-containing protein -
  KFV11_RS08395 (KFV11_08410) - 1619666..1620229 (-) 564 WP_254249700.1 hypothetical protein -
  KFV11_RS08400 (KFV11_08415) - 1620477..1621118 (+) 642 WP_254249701.1 hypothetical protein -
  KFV11_RS08405 (KFV11_08420) - 1621244..1622044 (-) 801 WP_254249702.1 CHAP domain-containing protein -
  KFV11_RS08410 (KFV11_08425) - 1622095..1622346 (-) 252 WP_254249703.1 phage holin -
  KFV11_RS08415 (KFV11_08430) - 1622376..1622669 (-) 294 WP_254249704.1 hypothetical protein -
  KFV11_RS08420 (KFV11_08435) - 1622748..1624982 (-) 2235 WP_254249705.1 hypothetical protein -
  KFV11_RS08425 (KFV11_08440) - 1624997..1625215 (-) 219 WP_254249706.1 hypothetical protein -
  KFV11_RS08430 (KFV11_08445) - 1625226..1626941 (-) 1716 WP_254249707.1 phage tail spike protein -
  KFV11_RS08435 (KFV11_08450) - 1626942..1627379 (-) 438 WP_254249708.1 hypothetical protein -
  KFV11_RS08440 (KFV11_08455) - 1627376..1635475 (-) 8100 WP_254249709.1 phage tail tape measure protein -
  KFV11_RS08445 (KFV11_08460) - 1635522..1635707 (-) 186 WP_254249710.1 hypothetical protein -
  KFV11_RS08450 (KFV11_08465) - 1635749..1636183 (-) 435 WP_254249711.1 hypothetical protein -
  KFV11_RS08455 (KFV11_08470) - 1636253..1636498 (-) 246 WP_254249712.1 hypothetical protein -
  KFV11_RS08460 (KFV11_08475) - 1636512..1637153 (-) 642 WP_254249713.1 major tail protein -
  KFV11_RS08465 (KFV11_08480) - 1637172..1637567 (-) 396 WP_254249714.1 DUF3168 domain-containing protein -
  KFV11_RS08470 (KFV11_08485) - 1637560..1637937 (-) 378 WP_254249715.1 HK97-gp10 family putative phage morphogenesis protein -
  KFV11_RS08475 (KFV11_08490) - 1637934..1638284 (-) 351 WP_254249716.1 phage head closure protein -
  KFV11_RS08480 (KFV11_08495) - 1638271..1638594 (-) 324 WP_254249717.1 head-tail connector protein -
  KFV11_RS08485 (KFV11_08500) - 1638608..1639738 (-) 1131 WP_254249718.1 phage major capsid protein -
  KFV11_RS08490 (KFV11_08505) - 1639856..1640557 (-) 702 WP_254249719.1 head maturation protease, ClpP-related -
  KFV11_RS08495 (KFV11_08510) - 1640538..1641788 (-) 1251 WP_254249720.1 phage portal protein -
  KFV11_RS08500 (KFV11_08515) - 1641971..1643665 (-) 1695 WP_254249721.1 terminase TerL endonuclease subunit -
  KFV11_RS08505 (KFV11_08520) - 1643665..1644180 (-) 516 WP_254249722.1 phage terminase small subunit P27 family -
  KFV11_RS08510 (KFV11_08525) - 1644314..1645162 (-) 849 WP_254249723.1 HNH endonuclease -
  KFV11_RS08515 (KFV11_08530) - 1645305..1645760 (-) 456 WP_254249724.1 hypothetical protein -
  KFV11_RS08520 (KFV11_08535) - 1645862..1646326 (-) 465 WP_254249725.1 ArpU family phage packaging/lysis transcriptional regulator -
  KFV11_RS08525 (KFV11_08540) - 1646398..1646556 (-) 159 WP_254249726.1 hypothetical protein -
  KFV11_RS08530 (KFV11_08545) - 1646558..1646887 (-) 330 WP_254249727.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  KFV11_RS08535 (KFV11_08550) - 1646884..1647267 (-) 384 WP_254249728.1 hypothetical protein -
  KFV11_RS08540 (KFV11_08555) - 1647283..1647480 (-) 198 WP_302054863.1 RusA family crossover junction endodeoxyribonuclease -
  KFV11_RS08545 (KFV11_08560) - 1647860..1648021 (-) 162 WP_254249729.1 hypothetical protein -
  KFV11_RS08550 (KFV11_08565) - 1648018..1648221 (-) 204 WP_149459397.1 hypothetical protein -
  KFV11_RS08555 (KFV11_08570) - 1648232..1648480 (-) 249 WP_254249730.1 hypothetical protein -
  KFV11_RS08560 (KFV11_08575) - 1648565..1648840 (-) 276 WP_254249731.1 hypothetical protein -
  KFV11_RS08565 (KFV11_08580) - 1648856..1649107 (-) 252 WP_254249732.1 hypothetical protein -
  KFV11_RS08570 (KFV11_08585) - 1649094..1649468 (-) 375 WP_254249733.1 YopX family protein -
  KFV11_RS08575 (KFV11_08590) ssbA 1649480..1649974 (-) 495 WP_254249734.1 single-stranded DNA-binding protein Machinery gene
  KFV11_RS08580 (KFV11_08595) - 1649964..1650278 (-) 315 WP_149459403.1 hypothetical protein -
  KFV11_RS08585 (KFV11_08600) - 1650282..1650476 (-) 195 WP_367305192.1 DUF6877 family protein -
  KFV11_RS08590 (KFV11_08605) - 1650483..1651385 (-) 903 WP_254249736.1 helix-turn-helix domain-containing protein -
  KFV11_RS08595 (KFV11_08610) - 1651363..1651656 (-) 294 WP_254249737.1 hypothetical protein -
  KFV11_RS08600 (KFV11_08615) - 1651653..1652363 (-) 711 WP_254249738.1 Rha family transcriptional regulator -
  KFV11_RS08605 (KFV11_08620) - 1652482..1652703 (+) 222 WP_254249739.1 hypothetical protein -
  KFV11_RS08610 (KFV11_08625) - 1652678..1652884 (-) 207 WP_254249740.1 hypothetical protein -
  KFV11_RS08615 (KFV11_08630) - 1652874..1653086 (-) 213 WP_254249741.1 hypothetical protein -
  KFV11_RS08620 (KFV11_08635) - 1653086..1653406 (-) 321 WP_254249742.1 DUF771 domain-containing protein -
  KFV11_RS08625 (KFV11_08640) - 1653418..1653675 (-) 258 WP_254249743.1 hypothetical protein -
  KFV11_RS08630 (KFV11_08645) - 1653845..1654228 (+) 384 WP_254249744.1 helix-turn-helix domain-containing protein -
  KFV11_RS08635 (KFV11_08650) - 1654240..1654665 (+) 426 WP_254249745.1 ImmA/IrrE family metallo-endopeptidase -
  KFV11_RS08640 (KFV11_08655) - 1654749..1655582 (+) 834 WP_254249746.1 hypothetical protein -
  KFV11_RS08645 (KFV11_08660) - 1655681..1656757 (+) 1077 WP_254249747.1 site-specific integrase -
  KFV11_RS08705 (KFV11_08720) - 1658208..1658783 (-) 576 WP_149459413.1 competence protein ComK -
  KFV11_RS08710 (KFV11_08725) - 1658989..1659198 (+) 210 WP_149459414.1 IDEAL domain-containing protein -
  KFV11_RS08715 (KFV11_08730) - 1659273..1660253 (-) 981 WP_149459415.1 lipoate--protein ligase -
  KFV11_RS08720 (KFV11_08735) hemY 1660399..1661778 (-) 1380 WP_254249748.1 protoporphyrinogen oxidase -
  KFV11_RS08725 (KFV11_08740) hemH 1661797..1662717 (-) 921 WP_254249749.1 ferrochelatase -
  KFV11_RS08730 (KFV11_08745) hemE 1662731..1663783 (-) 1053 WP_149459418.1 uroporphyrinogen decarboxylase -
  KFV11_RS08735 (KFV11_08750) - 1663914..1664411 (+) 498 WP_254249750.1 hypothetical protein -
  KFV11_RS08740 (KFV11_08755) - 1664483..1665700 (-) 1218 WP_254249751.1 ABC transporter permease -
  KFV11_RS08745 (KFV11_08760) - 1665693..1666430 (-) 738 WP_254249752.1 ABC transporter ATP-binding protein -
  KFV11_RS08750 (KFV11_08765) - 1666541..1666954 (+) 414 WP_254249753.1 HIT family protein -
  KFV11_RS08755 (KFV11_08770) - 1667002..1667358 (+) 357 WP_254249754.1 YtxH domain-containing protein -
  KFV11_RS08760 (KFV11_08775) - 1667443..1667988 (+) 546 WP_254249755.1 HTH-type transcriptional regulator Hpr -
  KFV11_RS08765 (KFV11_08780) - 1668034..1668579 (+) 546 WP_254249756.1 DUF3267 domain-containing protein -
  KFV11_RS08770 (KFV11_08785) - 1668678..1669604 (+) 927 WP_149459426.1 peptidylprolyl isomerase -
  KFV11_RS08775 (KFV11_08790) yhaM 1669643..1670584 (-) 942 WP_149459427.1 3'-5' exoribonuclease YhaM -
  KFV11_RS08780 (KFV11_08795) - 1670584..1673487 (-) 2904 WP_254249757.1 AAA family ATPase -
  KFV11_RS08785 (KFV11_08800) - 1673484..1674665 (-) 1182 WP_149459429.1 DNA repair exonuclease -

Sequence

Protein


Download         Length: 164 a.a.        Molecular weight: 17824.69 Da        Isoelectric Point: 4.7687

>NTDB_id=560939 KFV11_RS08575 WP_254249734.1 1649480..1649974(-) (ssbA) [Macrococcus equipercicus strain Epi0143-OL]
MINRVVLVGRLTKDPEYRVTPSGVAVATFTLAVNRNFTNAQGERQADFLNCIIFRKQAENVNAYLSKGNLAGVDGRLQSR
SYDNQEGRKVYVTEVVCDSVQFLEPKGSREKQVEDIYNEYTGGEAQGTNTAASAASSNLAPGAGNNPFANHTGPIDISDD
DMPF

Nucleotide


Download         Length: 495 bp        

>NTDB_id=560939 KFV11_RS08575 WP_254249734.1 1649480..1649974(-) (ssbA) [Macrococcus equipercicus strain Epi0143-OL]
ATGATAAATAGAGTGGTATTAGTCGGACGTCTAACTAAAGACCCTGAATACAGAGTCACACCATCAGGCGTGGCAGTGGC
CACGTTCACACTGGCAGTCAACCGCAACTTTACTAACGCGCAGGGCGAGCGGCAGGCAGACTTTCTGAACTGCATCATCT
TCCGCAAACAGGCTGAGAACGTCAACGCTTACCTCAGCAAAGGCAATCTGGCAGGAGTGGACGGCCGTCTGCAGTCACGG
TCCTATGATAATCAGGAGGGCCGCAAAGTATATGTGACTGAAGTCGTCTGTGACTCAGTGCAGTTTCTCGAGCCGAAGGG
CAGCAGAGAGAAGCAAGTGGAGGATATCTACAACGAATATACAGGCGGAGAGGCACAGGGAACAAACACAGCCGCTTCCG
CTGCCAGCTCAAATCTAGCACCAGGAGCAGGCAACAATCCATTCGCAAATCATACAGGGCCAATAGACATCAGTGATGAT
GATATGCCGTTCTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

56.818

100

0.61
  ssb Latilactobacillus sakei subsp. sakei 23K

51.765

100

0.537
  ssbB Bacillus subtilis subsp. subtilis str. 168

60.36

67.683

0.409