Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | KFV07_RS05805 | Genome accession | NZ_CP073804 |
| Coordinates | 1140098..1140604 (+) | Length | 168 a.a. |
| NCBI ID | WP_254256251.1 | Uniprot ID | - |
| Organism | Macrococcoides canis strain Epi0100-OL | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1109713..1143237 | 1140098..1140604 | within | 0 |
Gene organization within MGE regions
Location: 1109713..1143237
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KFV07_RS05625 (KFV07_05630) | mutS | 1109967..1112507 (+) | 2541 | WP_211553288.1 | DNA mismatch repair protein MutS | - |
| KFV07_RS05630 (KFV07_05635) | mutL | 1112517..1114424 (+) | 1908 | WP_211553286.1 | DNA mismatch repair endonuclease MutL | - |
| KFV07_RS05635 (KFV07_05640) | - | 1114424..1114966 (+) | 543 | WP_164942074.1 | glycerol-3-phosphate responsive antiterminator | - |
| KFV07_RS05640 (KFV07_05645) | - | 1115098..1115916 (+) | 819 | WP_210152964.1 | MIP/aquaporin family protein | - |
| KFV07_RS05645 (KFV07_05650) | glpK | 1115935..1117428 (+) | 1494 | WP_211553284.1 | glycerol kinase GlpK | - |
| KFV07_RS05650 (KFV07_05655) | - | 1117449..1119122 (+) | 1674 | WP_211553276.1 | glycerol-3-phosphate dehydrogenase/oxidase | - |
| KFV07_RS05655 (KFV07_05660) | - | 1119240..1120133 (+) | 894 | WP_164942078.1 | alpha/beta fold hydrolase | - |
| KFV07_RS05660 (KFV07_05665) | miaA | 1120126..1121064 (+) | 939 | WP_211553274.1 | tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA | - |
| KFV07_RS05665 (KFV07_05670) | hfq | 1121048..1121245 (+) | 198 | WP_086042430.1 | RNA chaperone Hfq | - |
| KFV07_RS05670 (KFV07_05675) | - | 1121305..1121778 (-) | 474 | WP_138071048.1 | glutathione peroxidase | - |
| KFV07_RS05675 (KFV07_05680) | hflX | 1121837..1123114 (+) | 1278 | WP_211553272.1 | GTPase HflX | - |
| KFV07_RS05680 (KFV07_05685) | - | 1123121..1124380 (+) | 1260 | WP_164942081.1 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
| KFV07_RS05685 (KFV07_05690) | - | 1124467..1124820 (+) | 354 | WP_414738931.1 | MerR family transcriptional regulator | - |
| KFV07_RS05690 (KFV07_05695) | glnA | 1124837..1126174 (+) | 1338 | WP_164942082.1 | type I glutamate--ammonia ligase | - |
| KFV07_RS05695 (KFV07_05700) | - | 1126283..1127437 (-) | 1155 | WP_174804826.1 | tyrosine-type recombinase/integrase | - |
| KFV07_RS05700 (KFV07_05705) | - | 1127442..1127903 (-) | 462 | WP_254256240.1 | ImmA/IrrE family metallo-endopeptidase | - |
| KFV07_RS05705 (KFV07_05710) | - | 1128021..1129094 (-) | 1074 | WP_164953388.1 | DUF4352 domain-containing protein | - |
| KFV07_RS05710 (KFV07_05715) | - | 1129107..1130180 (-) | 1074 | WP_164953389.1 | type I restriction endonuclease | - |
| KFV07_RS05715 (KFV07_05720) | - | 1130199..1130540 (-) | 342 | WP_133454954.1 | helix-turn-helix transcriptional regulator | - |
| KFV07_RS05720 (KFV07_05725) | - | 1130694..1130945 (+) | 252 | WP_086042725.1 | helix-turn-helix transcriptional regulator | - |
| KFV07_RS05725 (KFV07_05730) | - | 1131061..1131564 (+) | 504 | WP_188020096.1 | hypothetical protein | - |
| KFV07_RS05730 (KFV07_05735) | - | 1131578..1131823 (+) | 246 | WP_254256241.1 | hypothetical protein | - |
| KFV07_RS05735 (KFV07_05740) | - | 1131825..1132016 (+) | 192 | WP_086042722.1 | hypothetical protein | - |
| KFV07_RS05740 (KFV07_05745) | - | 1132017..1132256 (+) | 240 | WP_086042721.1 | hypothetical protein | - |
| KFV07_RS05745 (KFV07_05750) | - | 1132342..1133103 (+) | 762 | WP_254256242.1 | phage antirepressor KilAC domain-containing protein | - |
| KFV07_RS05750 (KFV07_05755) | - | 1133100..1133282 (+) | 183 | WP_086042719.1 | hypothetical protein | - |
| KFV07_RS05755 (KFV07_05760) | - | 1133282..1135258 (+) | 1977 | WP_254256243.1 | AAA family ATPase | - |
| KFV07_RS05760 (KFV07_05765) | bet | 1135260..1136012 (+) | 753 | WP_254256244.1 | phage recombination protein Bet | - |
| KFV07_RS05765 (KFV07_05770) | - | 1136012..1136728 (+) | 717 | WP_254256245.1 | MBL fold metallo-hydrolase | - |
| KFV07_RS05770 (KFV07_05775) | - | 1136742..1137620 (+) | 879 | WP_254256246.1 | phage replisome organizer N-terminal domain-containing protein | - |
| KFV07_RS05775 (KFV07_05780) | - | 1137598..1138383 (+) | 786 | WP_254256247.1 | ATP-binding protein | - |
| KFV07_RS05780 (KFV07_05785) | - | 1138410..1139030 (+) | 621 | WP_254256248.1 | hypothetical protein | - |
| KFV07_RS05785 (KFV07_05790) | - | 1139023..1139199 (+) | 177 | WP_254256249.1 | hypothetical protein | - |
| KFV07_RS05790 (KFV07_05795) | - | 1139171..1139347 (+) | 177 | WP_254256250.1 | hypothetical protein | - |
| KFV07_RS05795 (KFV07_05800) | - | 1139344..1139538 (+) | 195 | WP_086042713.1 | hypothetical protein | - |
| KFV07_RS05800 (KFV07_05805) | - | 1139584..1140105 (+) | 522 | WP_164953403.1 | HNH endonuclease | - |
| KFV07_RS05805 (KFV07_05810) | ssbA | 1140098..1140604 (+) | 507 | WP_254256251.1 | single-stranded DNA-binding protein | Machinery gene |
| KFV07_RS05810 (KFV07_05815) | - | 1140619..1140852 (+) | 234 | WP_188020107.1 | hypothetical protein | - |
| KFV07_RS05815 (KFV07_05820) | - | 1140854..1141456 (+) | 603 | WP_254256252.1 | HNH endonuclease signature motif containing protein | - |
| KFV07_RS05820 (KFV07_05825) | - | 1141524..1142750 (+) | 1227 | WP_254256253.1 | N-6 DNA methylase | - |
| KFV07_RS05825 (KFV07_05830) | - | 1142734..1143153 (+) | 420 | WP_254256254.1 | restriction endonuclease subunit S | - |
Sequence
Protein
Download Length: 168 a.a. Molecular weight: 18895.63 Da Isoelectric Point: 7.7734
>NTDB_id=560831 KFV07_RS05805 WP_254256251.1 1140098..1140604(+) (ssbA) [Macrococcoides canis strain Epi0100-OL]
MINRVVLVGRLTADPQYRVTPSGVSVATFTLAINRNFTNAQGKRQADFINCIVFRKQAENVNNYLNKGSLAGVEGRLQSR
SYDNKEGQRVFVTEVICDSVQFLEPKNSQNQQNNGTQQTNYNQTNNNYQNNQNVNRGQNNANNGYEQKQDPFANATGPID
INDDDLPF
MINRVVLVGRLTADPQYRVTPSGVSVATFTLAINRNFTNAQGKRQADFINCIVFRKQAENVNNYLNKGSLAGVEGRLQSR
SYDNKEGQRVFVTEVICDSVQFLEPKNSQNQQNNGTQQTNYNQTNNNYQNNQNVNRGQNNANNGYEQKQDPFANATGPID
INDDDLPF
Nucleotide
Download Length: 507 bp
>NTDB_id=560831 KFV07_RS05805 WP_254256251.1 1140098..1140604(+) (ssbA) [Macrococcoides canis strain Epi0100-OL]
ATGATTAATCGAGTTGTGCTTGTAGGAAGGCTTACGGCTGATCCACAATATCGCGTAACACCATCAGGAGTTTCGGTAGC
AACCTTTACACTTGCAATCAATCGTAACTTTACTAATGCGCAAGGTAAACGACAAGCTGATTTTATCAACTGTATCGTAT
TTCGTAAACAAGCCGAAAACGTAAATAACTATCTCAACAAAGGTTCATTAGCAGGAGTTGAAGGTCGTCTCCAATCACGC
AGCTACGATAACAAAGAAGGACAGCGTGTATTCGTTACAGAAGTGATTTGTGATAGTGTGCAGTTCCTGGAACCAAAGAA
TAGCCAAAATCAACAAAATAACGGCACACAACAAACAAATTACAATCAGACGAACAACAACTATCAAAATAATCAAAACG
TCAACAGAGGCCAAAATAACGCAAATAACGGATATGAGCAGAAGCAAGATCCATTTGCAAACGCAACAGGACCGATTGAT
ATCAATGATGATGATTTACCGTTCTAA
ATGATTAATCGAGTTGTGCTTGTAGGAAGGCTTACGGCTGATCCACAATATCGCGTAACACCATCAGGAGTTTCGGTAGC
AACCTTTACACTTGCAATCAATCGTAACTTTACTAATGCGCAAGGTAAACGACAAGCTGATTTTATCAACTGTATCGTAT
TTCGTAAACAAGCCGAAAACGTAAATAACTATCTCAACAAAGGTTCATTAGCAGGAGTTGAAGGTCGTCTCCAATCACGC
AGCTACGATAACAAAGAAGGACAGCGTGTATTCGTTACAGAAGTGATTTGTGATAGTGTGCAGTTCCTGGAACCAAAGAA
TAGCCAAAATCAACAAAATAACGGCACACAACAAACAAATTACAATCAGACGAACAACAACTATCAAAATAATCAAAACG
TCAACAGAGGCCAAAATAACGCAAATAACGGATATGAGCAGAAGCAAGATCCATTTGCAAACGCAACAGGACCGATTGAT
ATCAATGATGATGATTTACCGTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
59.091 |
100 |
0.619 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.353 |
100 |
0.53 |
| ssb | Glaesserella parasuis strain SC1401 |
36.111 |
100 |
0.387 |