Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   C663_RS11945 Genome accession   NC_020244
Coordinates   2405308..2405481 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis XF-1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2400308..2410481
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C663_RS11930 (C663_2340) gcvT 2401107..2402195 (-) 1089 WP_015384081.1 glycine cleavage system aminomethyltransferase GcvT -
  C663_RS11935 (C663_2341) yqhH 2402637..2404310 (+) 1674 WP_015384082.1 SNF2-related protein -
  C663_RS11940 (C663_2342) yqhG 2404331..2405125 (+) 795 WP_003230200.1 YqhG family protein -
  C663_RS11945 (C663_2343) sinI 2405308..2405481 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  C663_RS11950 (C663_2344) sinR 2405515..2405850 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  C663_RS11955 (C663_2345) tasA 2405943..2406728 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  C663_RS11960 (C663_2346) sipW 2406792..2407364 (-) 573 WP_080030740.1 signal peptidase I -
  C663_RS11965 (C663_2347) tapA 2407348..2408109 (-) 762 WP_015384085.1 amyloid fiber anchoring/assembly protein TapA -
  C663_RS11970 (C663_2348) yqzG 2408379..2408705 (+) 327 WP_015384086.1 YqzG/YhdC family protein -
  C663_RS11975 (C663_2349) spoIIT 2408747..2408926 (-) 180 WP_003230176.1 YqzE family protein -
  C663_RS11980 (C663_2350) comGG 2408998..2409372 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  C663_RS11985 (C663_2351) comGF 2409373..2409756 (-) 384 WP_015384087.1 ComG operon protein ComGF Machinery gene
  C663_RS11990 (C663_2352) comGE 2409782..2410129 (-) 348 WP_015384088.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=56004 C663_RS11945 WP_003230187.1 2405308..2405481(+) (sinI) [Bacillus subtilis XF-1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=56004 C663_RS11945 WP_003230187.1 2405308..2405481(+) (sinI) [Bacillus subtilis XF-1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment