Detailed information NTG0559926

Bioinformatically predicted

Overview

• Name: nucA/comI
• Type: Machinery gene
• Locus tag: KAI37_RS14250
• Genome accession: NZ_CP073683
• Coordinates: 3287478..3287903 (-)
• Length: 141 a.a.
• NCBI ID: WP_220031485.1
• Uniprot ID: -
• Organism: Paenibacillus sp. S25
• Function: cleavage of dsDNA into ssDNA (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	3283631..3297202	3287478..3287903	within	0

Gene organization within MGE regions

Location: 3283631..3297202

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
KAI37_RS14235 (KAI37_02891)	-	3283631..3284773 (-)	1143	WP_220029683.1	hypothetical protein	-
KAI37_RS14240 (KAI37_02892)	-	3285026..3286072 (-)	1047	WP_220029684.1	fibronectin type III domain-containing protein	-
KAI37_RS14245 (KAI37_02893)	-	3286249..3287304 (-)	1056	WP_220029685.1	fibronectin type III domain-containing protein	-
KAI37_RS14250 (KAI37_02894)	nucA/comI	3287478..3287903 (-)	426	WP_220031485.1	NucA/NucB deoxyribonuclease domain-containing protein	Machinery gene
KAI37_RS26440 (KAI37_02895)	-	3288143..3288931 (+)	789	WP_258382980.1	hypothetical protein	-
KAI37_RS14260 (KAI37_02896)	-	3288954..3289187 (-)	234	WP_220029686.1	hypothetical protein	-
KAI37_RS14265 (KAI37_02897)	-	3289242..3289847 (-)	606	WP_220029687.1	DUF1643 domain-containing protein	-
KAI37_RS14270 (KAI37_02898)	-	3290079..3291110 (+)	1032	WP_220029688.1	hypothetical protein	-
KAI37_RS14275 (KAI37_02900)	-	3291436..3291990 (-)	555	WP_220029689.1	phage holin, LLH family	-
KAI37_RS14280 (KAI37_02901)	-	3291993..3292946 (-)	954	WP_220029690.1	GH25 family lysozyme	-
KAI37_RS14285 (KAI37_02902)	-	3292924..3293427 (-)	504	WP_220029691.1	phage holin family protein	-
KAI37_RS14290 (KAI37_02903)	-	3293402..3293623 (-)	222	WP_220029692.1	hypothetical protein	-
KAI37_RS26445 (KAI37_02904)	-	3293663..3294403 (-)	741	WP_258382981.1	phage antirepressor KilAC domain-containing protein	-
KAI37_RS14300 (KAI37_02905)	-	3294696..3295694 (+)	999	WP_076294669.1	hypothetical protein	-
KAI37_RS14305 (KAI37_02906)	-	3295955..3296548 (-)	594	WP_076294668.1	hypothetical protein	-
KAI37_RS14310 (KAI37_02907)	-	3296585..3297202 (-)	618	WP_220029693.1	2,' 3'-cyclic nucleotide 2'-phosphodiesterase	-

Sequence

Protein

• Length: 141 a.a.
• Molecular weight: 15331.30 Da
• Isoelectric Point: 7.8660

>NTDB_id=559926 KAI37_RS14250 WP_220031485.1 3287478..3287903(-) (nucA/comI) [Paenibacillus sp. S25]
MKGIVRGLIVFLLAAIFSVQGVYAEPVSRSVQAATGYTLEFPSSRYPETGAHIRDAIAAGHSSVCTIDRDGAEENRKESL
KGYPTKKGYDRDEWPMAMCAEGGAGADIRYITPSDNRGAGSWVSHQLDKYADGTKVRFIVK

Nucleotide

• Length: 426 bp

>NTDB_id=559926 KAI37_RS14250 WP_220031485.1 3287478..3287903(-) (nucA/comI) [Paenibacillus sp. S25]
ATAAAAGGAATCGTAAGAGGATTAATTGTATTTTTACTAGCTGCTATCTTTTCCGTACAAGGTGTTTATGCAGAACCTGT
TTCGAGAAGTGTACAAGCAGCAACTGGGTATACGTTGGAATTTCCAAGTTCACGGTATCCTGAAACCGGAGCACATATTA
GAGATGCAATAGCAGCCGGACATTCTTCGGTATGTACGATTGATCGTGATGGAGCTGAGGAAAACAGGAAGGAGTCACTC
AAGGGCTATCCTACTAAAAAAGGATATGACCGGGATGAATGGCCGATGGCAATGTGTGCTGAAGGTGGCGCAGGCGCTGA
TATTCGATACATAACCCCTAGTGATAACCGGGGAGCAGGATCATGGGTAAGTCATCAGTTAGATAAGTATGCTGATGGAA
CAAAGGTAAGGTTCATAGTGAAATAA

Domains

Predicted by InterproScan.

• Deoxyribonuclease NucA/NucB (DNase_NucA_NucB) (44-137)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
nucA/comI	Bacillus subtilis subsp. subtilis str. 168	70.192	73.759	0.518