Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   KEC47_RS11470 Genome accession   NZ_CP073656
Coordinates   2440300..2440614 (-) Length   104 a.a.
NCBI ID   WP_077722594.1    Uniprot ID   -
Organism   Bacillus velezensis strain Y816     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2435300..2445614
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KEC47_RS11425 (KEC47_11425) sinI 2435983..2436156 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  KEC47_RS11430 (KEC47_11430) sinR 2436190..2436525 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KEC47_RS11435 (KEC47_11435) - 2436573..2437358 (-) 786 WP_007408329.1 TasA family protein -
  KEC47_RS11440 (KEC47_11440) - 2437422..2438006 (-) 585 WP_012117977.1 signal peptidase I -
  KEC47_RS11445 (KEC47_11445) tapA 2437978..2438649 (-) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  KEC47_RS11450 (KEC47_11450) - 2438908..2439237 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  KEC47_RS11455 (KEC47_11455) - 2439277..2439456 (-) 180 WP_003153093.1 YqzE family protein -
  KEC47_RS11460 (KEC47_11460) comGG 2439513..2439890 (-) 378 WP_077722592.1 competence type IV pilus minor pilin ComGG Machinery gene
  KEC47_RS11465 (KEC47_11465) comGF 2439891..2440286 (-) 396 WP_077722593.1 competence type IV pilus minor pilin ComGF -
  KEC47_RS11470 (KEC47_11470) comGE 2440300..2440614 (-) 315 WP_077722594.1 competence type IV pilus minor pilin ComGE Machinery gene
  KEC47_RS11475 (KEC47_11475) comGD 2440598..2441035 (-) 438 WP_077722595.1 competence type IV pilus minor pilin ComGD Machinery gene
  KEC47_RS11480 (KEC47_11480) comGC 2441025..2441333 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  KEC47_RS11485 (KEC47_11485) comGB 2441338..2442375 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  KEC47_RS11490 (KEC47_11490) comGA 2442362..2443432 (-) 1071 WP_070082113.1 competence type IV pilus ATPase ComGA Machinery gene
  KEC47_RS11495 (KEC47_11495) - 2443624..2444574 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11860.84 Da        Isoelectric Point: 6.9470

>NTDB_id=559737 KEC47_RS11470 WP_077722594.1 2440300..2440614(-) (comGE) [Bacillus velezensis strain Y816]
MLNGNKGFSTIETLSAMSIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=559737 KEC47_RS11470 WP_077722594.1 2440300..2440614(-) (comGE) [Bacillus velezensis strain Y816]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGTCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

44.348

100

0.49