Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   KEC47_RS11425 Genome accession   NZ_CP073656
Coordinates   2435983..2436156 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain Y816     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2430983..2441156
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KEC47_RS11410 (KEC47_11410) gcvT 2431800..2432900 (-) 1101 WP_176283424.1 glycine cleavage system aminomethyltransferase GcvT -
  KEC47_RS11415 (KEC47_11415) - 2433324..2434994 (+) 1671 WP_060562612.1 SNF2-related protein -
  KEC47_RS11420 (KEC47_11420) - 2435012..2435806 (+) 795 WP_014305407.1 YqhG family protein -
  KEC47_RS11425 (KEC47_11425) sinI 2435983..2436156 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  KEC47_RS11430 (KEC47_11430) sinR 2436190..2436525 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KEC47_RS11435 (KEC47_11435) - 2436573..2437358 (-) 786 WP_007408329.1 TasA family protein -
  KEC47_RS11440 (KEC47_11440) - 2437422..2438006 (-) 585 WP_012117977.1 signal peptidase I -
  KEC47_RS11445 (KEC47_11445) tapA 2437978..2438649 (-) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  KEC47_RS11450 (KEC47_11450) - 2438908..2439237 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  KEC47_RS11455 (KEC47_11455) - 2439277..2439456 (-) 180 WP_003153093.1 YqzE family protein -
  KEC47_RS11460 (KEC47_11460) comGG 2439513..2439890 (-) 378 WP_077722592.1 competence type IV pilus minor pilin ComGG Machinery gene
  KEC47_RS11465 (KEC47_11465) comGF 2439891..2440286 (-) 396 WP_077722593.1 competence type IV pilus minor pilin ComGF -
  KEC47_RS11470 (KEC47_11470) comGE 2440300..2440614 (-) 315 WP_077722594.1 competence type IV pilus minor pilin ComGE Machinery gene
  KEC47_RS11475 (KEC47_11475) comGD 2440598..2441035 (-) 438 WP_077722595.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=559734 KEC47_RS11425 WP_003153105.1 2435983..2436156(+) (sinI) [Bacillus velezensis strain Y816]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=559734 KEC47_RS11425 WP_003153105.1 2435983..2436156(+) (sinI) [Bacillus velezensis strain Y816]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCTCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702