Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   KCX77_RS02135 Genome accession   NZ_CP073265
Coordinates   440527..440646 (+) Length   39 a.a.
NCBI ID   WP_004430266.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain CNY01     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 435527..445646
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KCX77_RS02115 (KCX77_02115) - 436588..437931 (+) 1344 WP_212064169.1 MmgE/PrpD family protein -
  KCX77_RS02120 (KCX77_02120) - 438037..438717 (-) 681 WP_212064170.1 ABC transporter ATP-binding protein -
  KCX77_RS02125 (KCX77_02125) - 438735..439112 (-) 378 Protein_388 ABC transporter permease -
  KCX77_RS20840 - 439109..439201 (+) 93 Protein_389 hypothetical protein -
  KCX77_RS02130 (KCX77_02130) rapC 439395..440543 (+) 1149 WP_004430265.1 tetratricopeptide repeat protein Regulator
  KCX77_RS02135 (KCX77_02135) phrC 440527..440646 (+) 120 WP_004430266.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  KCX77_RS02140 (KCX77_02140) - 440780..440887 (-) 108 WP_106273028.1 YjcZ family sporulation protein -
  KCX77_RS02145 (KCX77_02145) - 441091..441198 (-) 108 WP_035192051.1 YjcZ family sporulation protein -
  KCX77_RS02150 (KCX77_02150) - 441305..442669 (-) 1365 WP_004430267.1 aspartate kinase -
  KCX77_RS02155 (KCX77_02155) ceuB 443102..444052 (+) 951 WP_212064171.1 ABC transporter permease Machinery gene
  KCX77_RS02160 (KCX77_02160) - 444045..444992 (+) 948 WP_010789704.1 iron chelate uptake ABC transporter family permease subunit -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4111.89 Da        Isoelectric Point: 7.9858

>NTDB_id=558604 KCX77_RS02135 WP_004430266.1 440527..440646(+) (phrC) [Bacillus atrophaeus strain CNY01]
MKLKSKLLIICLAAAAVFATVGVSNAEAPDYQVTERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=558604 KCX77_RS02135 WP_004430266.1 440527..440646(+) (phrC) [Bacillus atrophaeus strain CNY01]
ATGAAATTGAAATCTAAATTGCTCATTATTTGTTTGGCTGCAGCTGCTGTGTTTGCAACAGTTGGAGTGTCCAATGCTGA
AGCGCCTGATTATCAGGTGACAGAAAGAGGAATGACGTAA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

75

100

0.769