Detailed information NTG0552729

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: J7U00_RS01020
• Genome accession: NZ_CP072431
• Coordinates: 182338..182664 (+)
• Length: 108 a.a.
• NCBI ID: WP_002946126.1
• Uniprot ID: A0A0E2Q1B3
• Organism: Streptococcus thermophilus strain S24745
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 177338..187664

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
J7U00_RS01005 (J7U00_01020)	-	179975..180337 (+)	363	WP_014608746.1	DUF1033 family protein	-
J7U00_RS01010 (J7U00_01025)	comGA/cglA/cilD	180418..181359 (+)	942	WP_014608745.1	competence type IV pilus ATPase ComGA	Machinery gene
J7U00_RS01015 (J7U00_01030)	comYB	181241..182341 (+)	1101	WP_116920398.1	competence type IV pilus assembly protein ComGB	Machinery gene
J7U00_RS01020 (J7U00_01035)	comYC	182338..182664 (+)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
J7U00_RS01025 (J7U00_01040)	comYD	182624..183052 (+)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
J7U00_RS01030 (J7U00_01045)	comGE	183024..183317 (+)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	-
J7U00_RS01035 (J7U00_01050)	comYF	183301..183738 (+)	438	WP_014608742.1	competence type IV pilus minor pilin ComGF	Machinery gene
J7U00_RS01040 (J7U00_01055)	comGG	183716..184033 (+)	318	WP_002952035.1	competence type IV pilus minor pilin ComGG	-
J7U00_RS01045 (J7U00_01060)	comYH	184078..185034 (+)	957	WP_011226622.1	class I SAM-dependent methyltransferase	Machinery gene
J7U00_RS01050 (J7U00_01065)	-	185090..186283 (+)	1194	WP_014608740.1	acetate kinase	-
J7U00_RS01055 (J7U00_01070)	-	186532..186729 (+)	198	WP_011681682.1	helix-turn-helix transcriptional regulator	-
J7U00_RS01060	-	186741..187016 (+)	276	WP_011681681.1	hypothetical protein	-
J7U00_RS01065	-	187060..187398 (+)	339	WP_224103197.1	CPBP family intramembrane glutamic endopeptidase	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 11914.00 Da
• Isoelectric Point: 9.9219

>NTDB_id=552729 J7U00_RS01020 WP_002946126.1 182338..182664(+) (comYC) [Streptococcus thermophilus strain S24745]
MKLMLKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVS
EGQITQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 327 bp

>NTDB_id=552729 J7U00_RS01020 WP_002946126.1 182338..182664(+) (comYC) [Streptococcus thermophilus strain S24745]
ATGAAATTGATGTTAAAAAAATTGAATGCCGTTAAATTACGAGCCTTTACTCTGATTGAAATGCTAGTAGTACTTCTCAT
TATCAGTATTCTCCTTTTGCTCTTTGTTCCTAACTTAAGCAAGCAGAAGGATTCCGTTAAGGAAACTGGAAATGCGGCTG
TAGTCAAGGTCGTGGATTCTCAGGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTGGCAGCTCTTGTTTCA
GAAGGTCAAATTACGCAAAAACAGGCAGATTCATACAATGATTACTATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGC
CAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (14-34)

3D structure

• AlphaFold DB: A0A0E2Q1B3

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	69.231	96.296	0.667
comYC	Streptococcus mutans UA159	69.231	96.296	0.667
comYC	Streptococcus gordonii str. Challis substr. CH1	63.81	97.222	0.62
comGC/cglC	Streptococcus mitis SK321	62.264	98.148	0.611
comGC/cglC	Streptococcus mitis NCTC 12261	58.333	100	0.583
comGC/cglC	Streptococcus pneumoniae D39	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae R6	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae Rx1	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae TIGR4	58.491	98.148	0.574
comGC	Lactococcus lactis subsp. cremoris KW2	56.604	98.148	0.556
comYC	Streptococcus suis isolate S10	60.227	81.481	0.491
comGC	Staphylococcus aureus MW2	50	72.222	0.361
comGC	Staphylococcus aureus N315	50	72.222	0.361