Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | A7A1_RS08560 | Genome accession | NC_019896 |
| Coordinates | 1648571..1648744 (-) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis str. BSP1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1643571..1653744
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A7A1_RS08515 (A7A1_3572) | comGE | 1643921..1644268 (+) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
| A7A1_RS08520 (A7A1_3573) | comGF | 1644294..1644677 (+) | 384 | WP_015251713.1 | ComG operon protein ComGF | Machinery gene |
| A7A1_RS08525 (A7A1_3574) | comGG | 1644678..1645052 (+) | 375 | WP_015251714.1 | ComG operon protein ComGG | Machinery gene |
| A7A1_RS08530 (A7A1_3575) | spoIITA | 1645123..1645303 (+) | 181 | Protein_1684 | YqzE family protein | - |
| A7A1_RS08535 (A7A1_3576) | yqzG | 1645345..1645671 (-) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| A7A1_RS08540 (A7A1_3577) | tapA | 1645943..1646704 (+) | 762 | WP_015251716.1 | amyloid fiber anchoring/assembly protein TapA | - |
| A7A1_RS08545 (A7A1_3578) | sipW | 1646688..1647260 (+) | 573 | WP_003246088.1 | signal peptidase I SipW | - |
| A7A1_RS08550 (A7A1_3579) | tasA | 1647324..1648109 (+) | 786 | WP_015251717.1 | biofilm matrix protein TasA | - |
| A7A1_RS08555 (A7A1_3580) | sinR | 1648202..1648537 (-) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| A7A1_RS08560 (A7A1_3581) | sinI | 1648571..1648744 (-) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| A7A1_RS08565 (A7A1_3582) | yqhG | 1648927..1649721 (-) | 795 | WP_003230200.1 | YqhG family protein | - |
| A7A1_RS08570 (A7A1_3583) | hepAA | 1649742..1651414 (-) | 1673 | Protein_1692 | SNF2-related protein | - |
| A7A1_RS08575 (A7A1_3585) | gcvT | 1651856..1652944 (+) | 1089 | WP_015251720.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=55241 A7A1_RS08560 WP_003230187.1 1648571..1648744(-) (sinI) [Bacillus subtilis subsp. subtilis str. BSP1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=55241 A7A1_RS08560 WP_003230187.1 1648571..1648744(-) (sinI) [Bacillus subtilis subsp. subtilis str. BSP1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |