Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   J6B42_RS12210 Genome accession   NZ_CP072311
Coordinates   2497251..2497688 (-) Length   145 a.a.
NCBI ID   WP_025852922.1    Uniprot ID   -
Organism   Bacillus velezensis strain SC60     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2492251..2502688
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J6B42_RS12160 (J6B42_12090) sinI 2492636..2492809 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  J6B42_RS12165 (J6B42_12095) sinR 2492843..2493178 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  J6B42_RS12170 (J6B42_12100) - 2493226..2494011 (-) 786 WP_003153102.1 TasA family protein -
  J6B42_RS12175 (J6B42_12105) - 2494075..2494659 (-) 585 WP_025852917.1 signal peptidase I -
  J6B42_RS12180 (J6B42_12110) tapA 2494631..2495302 (-) 672 WP_025852919.1 amyloid fiber anchoring/assembly protein TapA -
  J6B42_RS12185 (J6B42_12115) - 2495561..2495890 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  J6B42_RS12190 (J6B42_12120) - 2495930..2496109 (-) 180 WP_003153093.1 YqzE family protein -
  J6B42_RS12195 (J6B42_12125) comGG 2496166..2496543 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  J6B42_RS12200 (J6B42_12130) comGF 2496544..2497044 (-) 501 WP_226565836.1 competence type IV pilus minor pilin ComGF -
  J6B42_RS12205 (J6B42_12135) comGE 2496953..2497267 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  J6B42_RS12210 (J6B42_12140) comGD 2497251..2497688 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  J6B42_RS12215 (J6B42_12145) comGC 2497678..2497986 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  J6B42_RS12220 (J6B42_12150) comGB 2497991..2499028 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  J6B42_RS12225 (J6B42_12155) comGA 2499015..2500085 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  J6B42_RS12230 (J6B42_12160) - 2500277..2501227 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -
  J6B42_RS12235 (J6B42_12165) - 2501373..2502674 (+) 1302 WP_014305416.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16268.78 Da        Isoelectric Point: 10.1850

>NTDB_id=551902 J6B42_RS12210 WP_025852922.1 2497251..2497688(-) (comGD) [Bacillus velezensis strain SC60]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSAGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=551902 J6B42_RS12210 WP_025852922.1 2497251..2497688(-) (comGD) [Bacillus velezensis strain SC60]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACTCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGCCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

54.795

100

0.552