Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   J6B42_RS12160 Genome accession   NZ_CP072311
Coordinates   2492636..2492809 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain SC60     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2487636..2497809
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J6B42_RS12145 (J6B42_12075) gcvT 2488454..2489554 (-) 1101 WP_003153108.1 glycine cleavage system aminomethyltransferase GcvT -
  J6B42_RS12150 (J6B42_12080) - 2489977..2491647 (+) 1671 WP_003153107.1 SNF2-related protein -
  J6B42_RS12155 (J6B42_12085) - 2491665..2492459 (+) 795 WP_014305407.1 YqhG family protein -
  J6B42_RS12160 (J6B42_12090) sinI 2492636..2492809 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  J6B42_RS12165 (J6B42_12095) sinR 2492843..2493178 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  J6B42_RS12170 (J6B42_12100) - 2493226..2494011 (-) 786 WP_003153102.1 TasA family protein -
  J6B42_RS12175 (J6B42_12105) - 2494075..2494659 (-) 585 WP_025852917.1 signal peptidase I -
  J6B42_RS12180 (J6B42_12110) tapA 2494631..2495302 (-) 672 WP_025852919.1 amyloid fiber anchoring/assembly protein TapA -
  J6B42_RS12185 (J6B42_12115) - 2495561..2495890 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  J6B42_RS12190 (J6B42_12120) - 2495930..2496109 (-) 180 WP_003153093.1 YqzE family protein -
  J6B42_RS12195 (J6B42_12125) comGG 2496166..2496543 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  J6B42_RS12200 (J6B42_12130) comGF 2496544..2497044 (-) 501 WP_226565836.1 competence type IV pilus minor pilin ComGF -
  J6B42_RS12205 (J6B42_12135) comGE 2496953..2497267 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  J6B42_RS12210 (J6B42_12140) comGD 2497251..2497688 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=551898 J6B42_RS12160 WP_003153105.1 2492636..2492809(+) (sinI) [Bacillus velezensis strain SC60]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=551898 J6B42_RS12160 WP_003153105.1 2492636..2492809(+) (sinI) [Bacillus velezensis strain SC60]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702