Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | J6B42_RS12160 | Genome accession | NZ_CP072311 |
| Coordinates | 2492636..2492809 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain SC60 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2487636..2497809
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| J6B42_RS12145 (J6B42_12075) | gcvT | 2488454..2489554 (-) | 1101 | WP_003153108.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| J6B42_RS12150 (J6B42_12080) | - | 2489977..2491647 (+) | 1671 | WP_003153107.1 | SNF2-related protein | - |
| J6B42_RS12155 (J6B42_12085) | - | 2491665..2492459 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| J6B42_RS12160 (J6B42_12090) | sinI | 2492636..2492809 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| J6B42_RS12165 (J6B42_12095) | sinR | 2492843..2493178 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| J6B42_RS12170 (J6B42_12100) | - | 2493226..2494011 (-) | 786 | WP_003153102.1 | TasA family protein | - |
| J6B42_RS12175 (J6B42_12105) | - | 2494075..2494659 (-) | 585 | WP_025852917.1 | signal peptidase I | - |
| J6B42_RS12180 (J6B42_12110) | tapA | 2494631..2495302 (-) | 672 | WP_025852919.1 | amyloid fiber anchoring/assembly protein TapA | - |
| J6B42_RS12185 (J6B42_12115) | - | 2495561..2495890 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| J6B42_RS12190 (J6B42_12120) | - | 2495930..2496109 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| J6B42_RS12195 (J6B42_12125) | comGG | 2496166..2496543 (-) | 378 | WP_014305410.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| J6B42_RS12200 (J6B42_12130) | comGF | 2496544..2497044 (-) | 501 | WP_226565836.1 | competence type IV pilus minor pilin ComGF | - |
| J6B42_RS12205 (J6B42_12135) | comGE | 2496953..2497267 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| J6B42_RS12210 (J6B42_12140) | comGD | 2497251..2497688 (-) | 438 | WP_025852922.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=551898 J6B42_RS12160 WP_003153105.1 2492636..2492809(+) (sinI) [Bacillus velezensis strain SC60]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=551898 J6B42_RS12160 WP_003153105.1 2492636..2492809(+) (sinI) [Bacillus velezensis strain SC60]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |