Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   J6B42_RS12195 Genome accession   NZ_CP072311
Coordinates   2496166..2496543 (-) Length   125 a.a.
NCBI ID   WP_014305410.1    Uniprot ID   -
Organism   Bacillus velezensis strain SC60     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2491166..2501543
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J6B42_RS12155 (J6B42_12085) - 2491665..2492459 (+) 795 WP_014305407.1 YqhG family protein -
  J6B42_RS12160 (J6B42_12090) sinI 2492636..2492809 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  J6B42_RS12165 (J6B42_12095) sinR 2492843..2493178 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  J6B42_RS12170 (J6B42_12100) - 2493226..2494011 (-) 786 WP_003153102.1 TasA family protein -
  J6B42_RS12175 (J6B42_12105) - 2494075..2494659 (-) 585 WP_025852917.1 signal peptidase I -
  J6B42_RS12180 (J6B42_12110) tapA 2494631..2495302 (-) 672 WP_025852919.1 amyloid fiber anchoring/assembly protein TapA -
  J6B42_RS12185 (J6B42_12115) - 2495561..2495890 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  J6B42_RS12190 (J6B42_12120) - 2495930..2496109 (-) 180 WP_003153093.1 YqzE family protein -
  J6B42_RS12195 (J6B42_12125) comGG 2496166..2496543 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  J6B42_RS12200 (J6B42_12130) comGF 2496544..2497044 (-) 501 WP_226565836.1 competence type IV pilus minor pilin ComGF -
  J6B42_RS12205 (J6B42_12135) comGE 2496953..2497267 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  J6B42_RS12210 (J6B42_12140) comGD 2497251..2497688 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  J6B42_RS12215 (J6B42_12145) comGC 2497678..2497986 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  J6B42_RS12220 (J6B42_12150) comGB 2497991..2499028 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  J6B42_RS12225 (J6B42_12155) comGA 2499015..2500085 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  J6B42_RS12230 (J6B42_12160) - 2500277..2501227 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14170.14 Da        Isoelectric Point: 9.9592

>NTDB_id=551900 J6B42_RS12195 WP_014305410.1 2496166..2496543(-) (comGG) [Bacillus velezensis strain SC60]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=551900 J6B42_RS12195 WP_014305410.1 2496166..2496543(-) (comGG) [Bacillus velezensis strain SC60]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512