Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   J4774_RS03030 Genome accession   NZ_CP072310
Coordinates   680575..680952 (-) Length   125 a.a.
NCBI ID   WP_014305410.1    Uniprot ID   -
Organism   Bacillus velezensis strain AD8     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 675575..685952
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J4774_RS02990 - 676073..676867 (+) 795 WP_139890050.1 YqhG family protein -
  J4774_RS02995 sinI 677044..677217 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  J4774_RS03000 sinR 677251..677586 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  J4774_RS03005 - 677634..678419 (-) 786 WP_015388008.1 TasA family protein -
  J4774_RS03010 - 678483..679067 (-) 585 WP_109567595.1 signal peptidase I -
  J4774_RS03015 tapA 679039..679710 (-) 672 WP_015388007.1 amyloid fiber anchoring/assembly protein TapA -
  J4774_RS03020 - 679970..680299 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  J4774_RS03025 - 680339..680518 (-) 180 WP_003153093.1 YqzE family protein -
  J4774_RS03030 comGG 680575..680952 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  J4774_RS03035 comGF 680953..681348 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  J4774_RS03040 comGE 681362..681676 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  J4774_RS03045 comGD 681660..682097 (-) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene
  J4774_RS03050 comGC 682087..682353 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  J4774_RS03055 comGB 682400..683437 (-) 1038 WP_139890049.1 competence type IV pilus assembly protein ComGB Machinery gene
  J4774_RS03060 comGA 683424..684494 (-) 1071 WP_139890048.1 competence type IV pilus ATPase ComGA Machinery gene
  J4774_RS03065 - 684686..685636 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14170.14 Da        Isoelectric Point: 9.9592

>NTDB_id=551787 J4774_RS03030 WP_014305410.1 680575..680952(-) (comGG) [Bacillus velezensis strain AD8]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=551787 J4774_RS03030 WP_014305410.1 680575..680952(-) (comGG) [Bacillus velezensis strain AD8]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512