Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   J4774_RS02995 Genome accession   NZ_CP072310
Coordinates   677044..677217 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain AD8     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 672044..682217
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J4774_RS02980 gcvT 672862..673962 (-) 1101 WP_014305405.1 glycine cleavage system aminomethyltransferase GcvT -
  J4774_RS02985 - 674385..676055 (+) 1671 WP_003153107.1 SNF2-related protein -
  J4774_RS02990 - 676073..676867 (+) 795 WP_139890050.1 YqhG family protein -
  J4774_RS02995 sinI 677044..677217 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  J4774_RS03000 sinR 677251..677586 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  J4774_RS03005 - 677634..678419 (-) 786 WP_015388008.1 TasA family protein -
  J4774_RS03010 - 678483..679067 (-) 585 WP_109567595.1 signal peptidase I -
  J4774_RS03015 tapA 679039..679710 (-) 672 WP_015388007.1 amyloid fiber anchoring/assembly protein TapA -
  J4774_RS03020 - 679970..680299 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  J4774_RS03025 - 680339..680518 (-) 180 WP_003153093.1 YqzE family protein -
  J4774_RS03030 comGG 680575..680952 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  J4774_RS03035 comGF 680953..681348 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  J4774_RS03040 comGE 681362..681676 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  J4774_RS03045 comGD 681660..682097 (-) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=551785 J4774_RS02995 WP_003153105.1 677044..677217(+) (sinI) [Bacillus velezensis strain AD8]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=551785 J4774_RS02995 WP_003153105.1 677044..677217(+) (sinI) [Bacillus velezensis strain AD8]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702