Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   B938_RS11820 Genome accession   NC_019842
Coordinates   2486536..2486913 (-) Length   125 a.a.
NCBI ID   WP_015240208.1    Uniprot ID   -
Organism   Bacillus velezensis AS43.3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2481536..2491913
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B938_RS11780 (B938_11850) - 2482034..2482828 (+) 795 WP_015240204.1 YqhG family protein -
  B938_RS11785 (B938_11855) sinI 2483005..2483178 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  B938_RS11790 (B938_11860) sinR 2483212..2483547 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  B938_RS11795 (B938_11865) tasA 2483595..2484380 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  B938_RS11800 (B938_11870) sipW 2484445..2485029 (-) 585 WP_015240205.1 signal peptidase I SipW -
  B938_RS11805 (B938_11875) tapA 2485001..2485672 (-) 672 WP_015240206.1 amyloid fiber anchoring/assembly protein TapA -
  B938_RS11810 (B938_11880) - 2485931..2486260 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  B938_RS11815 (B938_11885) - 2486300..2486479 (-) 180 WP_003153093.1 YqzE family protein -
  B938_RS11820 (B938_11890) comGG 2486536..2486913 (-) 378 WP_015240208.1 competence type IV pilus minor pilin ComGG Machinery gene
  B938_RS11825 (B938_11895) comGF 2486914..2487414 (-) 501 WP_257720329.1 competence type IV pilus minor pilin ComGF -
  B938_RS11830 (B938_11900) comGE 2487323..2487637 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  B938_RS11835 (B938_11905) comGD 2487621..2488058 (-) 438 WP_015240210.1 competence type IV pilus minor pilin ComGD Machinery gene
  B938_RS11840 (B938_11910) comGC 2488048..2488356 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  B938_RS11845 (B938_11915) comGB 2488361..2489398 (-) 1038 WP_015240211.1 competence type IV pilus assembly protein ComGB Machinery gene
  B938_RS11850 (B938_11920) comGA 2489385..2490455 (-) 1071 WP_015240212.1 competence type IV pilus ATPase ComGA Machinery gene
  B938_RS11855 (B938_11925) - 2490576..2491598 (-) 1023 WP_015240213.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14123.08 Da        Isoelectric Point: 9.9599

>NTDB_id=55155 B938_RS11820 WP_015240208.1 2486536..2486913(-) (comGG) [Bacillus velezensis AS43.3]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRRGAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=55155 B938_RS11820 WP_015240208.1 2486536..2486913(-) (comGG) [Bacillus velezensis AS43.3]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACCGGAACGAGACGGGG
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment