Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | B938_RS11785 | Genome accession | NC_019842 |
| Coordinates | 2483005..2483178 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis AS43.3 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2478005..2488178
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B938_RS11770 (B938_11840) | gcvT | 2478818..2479918 (-) | 1101 | WP_015240202.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| B938_RS11775 (B938_11845) | - | 2480342..2482012 (+) | 1671 | WP_015240203.1 | DEAD/DEAH box helicase | - |
| B938_RS11780 (B938_11850) | - | 2482034..2482828 (+) | 795 | WP_015240204.1 | YqhG family protein | - |
| B938_RS11785 (B938_11855) | sinI | 2483005..2483178 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| B938_RS11790 (B938_11860) | sinR | 2483212..2483547 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| B938_RS11795 (B938_11865) | tasA | 2483595..2484380 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| B938_RS11800 (B938_11870) | sipW | 2484445..2485029 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| B938_RS11805 (B938_11875) | tapA | 2485001..2485672 (-) | 672 | WP_015240206.1 | amyloid fiber anchoring/assembly protein TapA | - |
| B938_RS11810 (B938_11880) | - | 2485931..2486260 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| B938_RS11815 (B938_11885) | - | 2486300..2486479 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| B938_RS11820 (B938_11890) | comGG | 2486536..2486913 (-) | 378 | WP_015240208.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| B938_RS11825 (B938_11895) | comGF | 2486914..2487414 (-) | 501 | WP_257720329.1 | competence type IV pilus minor pilin ComGF | - |
| B938_RS11830 (B938_11900) | comGE | 2487323..2487637 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| B938_RS11835 (B938_11905) | comGD | 2487621..2488058 (-) | 438 | WP_015240210.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=55153 B938_RS11785 WP_003153105.1 2483005..2483178(+) (sinI) [Bacillus velezensis AS43.3]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=55153 B938_RS11785 WP_003153105.1 2483005..2483178(+) (sinI) [Bacillus velezensis AS43.3]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |