Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   J5D22_RS00200 Genome accession   NZ_CP071977
Coordinates   37620..37733 (+) Length   37 a.a.
NCBI ID   WP_001217877.1    Uniprot ID   A0A1A9H2U2
Organism   Helicobacter pylori strain MT5105     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 32620..42733
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J5D22_RS00175 (J5D22_00175) - 32661..34889 (+) 2229 WP_021172687.1 ATP-dependent Clp protease ATP-binding subunit -
  J5D22_RS00180 (J5D22_00180) panD 34879..35232 (+) 354 WP_000142286.1 aspartate 1-decarboxylase -
  J5D22_RS00185 (J5D22_00185) - 35235..35537 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  J5D22_RS00190 (J5D22_00190) - 35537..36541 (+) 1005 WP_209506533.1 PDZ domain-containing protein -
  J5D22_RS00195 (J5D22_00195) comB6 36549..37604 (+) 1056 WP_209506531.1 P-type conjugative transfer protein TrbL Machinery gene
  J5D22_RS00200 (J5D22_00200) comB7 37620..37733 (+) 114 WP_001217877.1 hypothetical protein Machinery gene
  J5D22_RS00205 (J5D22_00205) comB8 37730..38473 (+) 744 WP_021186670.1 virB8 family protein Machinery gene
  J5D22_RS00210 (J5D22_00210) comB9 38473..39459 (+) 987 WP_209505938.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  J5D22_RS00215 (J5D22_00215) comB10 39452..40588 (+) 1137 WP_209505939.1 DNA type IV secretion system protein ComB10 Machinery gene
  J5D22_RS00220 (J5D22_00220) - 40657..42069 (+) 1413 WP_209505940.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4291.23 Da        Isoelectric Point: 9.3572

>NTDB_id=549601 J5D22_RS00200 WP_001217877.1 37620..37733(+) (comB7) [Helicobacter pylori strain MT5105]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=549601 J5D22_RS00200 WP_001217877.1 37620..37733(+) (comB7) [Helicobacter pylori strain MT5105]
ATGAGGATTTTTTTTGTTATTATGGGACTTGTGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAGAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A1A9H2U2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

97.297

100

0.973