Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   J4048_RS15695 Genome accession   NZ_CP071970
Coordinates   3198909..3199049 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain XJ5     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3193909..3204049
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J4048_RS15670 (J4048_15670) - 3194223..3194606 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  J4048_RS15675 (J4048_15675) comA 3194628..3195272 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  J4048_RS15680 (J4048_15680) comP 3195353..3197659 (-) 2307 WP_208557092.1 histidine kinase Regulator
  J4048_RS15685 (J4048_15685) comX 3197682..3197852 (-) 171 WP_015418105.1 competence pheromone ComX -
  J4048_RS15690 (J4048_15690) - 3197849..3198778 (-) 930 WP_224462816.1 polyprenyl synthetase family protein -
  J4048_RS15695 (J4048_15695) degQ 3198909..3199049 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  J4048_RS15700 (J4048_15700) - 3199512..3199853 (+) 342 WP_015418107.1 hypothetical protein -
  J4048_RS15705 (J4048_15705) - 3199860..3201083 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  J4048_RS15710 (J4048_15710) - 3201213..3202679 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  J4048_RS15715 (J4048_15715) - 3202697..3203248 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  J4048_RS15720 (J4048_15720) - 3203345..3203743 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=549516 J4048_RS15695 WP_003152043.1 3198909..3199049(-) (degQ) [Bacillus amyloliquefaciens strain XJ5]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=549516 J4048_RS15695 WP_003152043.1 3198909..3199049(-) (degQ) [Bacillus amyloliquefaciens strain XJ5]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891