Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   J5F39_RS01055 Genome accession   NZ_CP071936
Coordinates   216200..216322 (+) Length   40 a.a.
NCBI ID   WP_283492014.1    Uniprot ID   -
Organism   Helicobacter pylori strain MTT03     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 211200..221322
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J5F39_RS01030 - 211241..213469 (+) 2229 WP_283492013.1 ATP-dependent Clp protease ATP-binding subunit -
  J5F39_RS01035 panD 213459..213812 (+) 354 WP_077642785.1 aspartate 1-decarboxylase -
  J5F39_RS01040 - 213815..214117 (+) 303 WP_000347931.1 YbaB/EbfC family nucleoid-associated protein -
  J5F39_RS01045 - 214117..215121 (+) 1005 WP_283492255.1 PDZ domain-containing protein -
  J5F39_RS01050 comB6 215129..216184 (+) 1056 WP_283492256.1 P-type conjugative transfer protein TrbL Machinery gene
  J5F39_RS01055 comB7 216200..216322 (+) 123 WP_283492014.1 comB7 lipoprotein Machinery gene
  J5F39_RS01060 comB8 216319..217062 (+) 744 WP_283492015.1 virB8 family protein Machinery gene
  J5F39_RS01065 comB9 217062..218036 (+) 975 WP_078290899.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  J5F39_RS01070 comB10 218029..219159 (+) 1131 WP_283492016.1 DNA type IV secretion system protein ComB10 Machinery gene
  J5F39_RS01075 - 219229..220641 (+) 1413 WP_283492017.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 40 a.a.        Molecular weight: 4665.67 Da        Isoelectric Point: 9.3572

>NTDB_id=549279 J5F39_RS01055 WP_283492014.1 216200..216322(+) (comB7) [Helicobacter pylori strain MTT03]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLLNLA

Nucleotide


Download         Length: 123 bp        

>NTDB_id=549279 J5F39_RS01055 WP_283492014.1 216200..216322(+) (comB7) [Helicobacter pylori strain MTT03]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

90

0.9