Detailed information    

insolico Bioinformatically predicted

Overview

Name   clpX   Type   Regulator
Locus tag   J4Q32_RS07370 Genome accession   NZ_CP071916
Coordinates   1445005..1446237 (-) Length   410 a.a.
NCBI ID   WP_001814787.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain 19A-19087     
Function   require for competence development (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1394054..1455297 1445005..1446237 within 0


Gene organization within MGE regions


Location: 1394054..1455297
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J4Q32_RS07065 (J4Q32_07075) - 1394054..1395253 (-) 1200 WP_001865572.1 CCA tRNA nucleotidyltransferase -
  J4Q32_RS07070 (J4Q32_07080) dapB 1395250..1396017 (-) 768 WP_000027902.1 4-hydroxy-tetrahydrodipicolinate reductase -
  J4Q32_RS07075 (J4Q32_07085) - 1396294..1397142 (-) 849 WP_000762070.1 DegV family protein -
  J4Q32_RS07080 (J4Q32_07090) - 1397144..1397518 (-) 375 WP_001050086.1 DUF1149 family protein -
  J4Q32_RS07085 (J4Q32_07095) glmM 1397592..1398944 (-) 1353 WP_000521410.1 phosphoglucosamine mutase -
  J4Q32_RS07090 (J4Q32_07100) - 1398968..1399747 (-) 780 WP_000742290.1 YbbR-like domain-containing protein -
  J4Q32_RS07095 (J4Q32_07105) cdaA 1399734..1400591 (-) 858 WP_001011058.1 diadenylate cyclase CdaA -
  J4Q32_RS07100 (J4Q32_07110) - 1400727..1401695 (+) 969 WP_000081004.1 NAD(P)/FAD-dependent oxidoreductase -
  J4Q32_RS07105 (J4Q32_07115) lytA 1401947..1402903 (-) 957 WP_233922948.1 N-acetylmuramoyl-L-alanine amidase LytA -
  J4Q32_RS07110 (J4Q32_07120) - 1402907..1403239 (-) 333 WP_001186242.1 phage holin -
  J4Q32_RS07115 (J4Q32_07125) - 1403243..1403659 (-) 417 WP_000687454.1 phage holin family protein -
  J4Q32_RS07120 (J4Q32_07130) - 1403669..1403932 (-) 264 WP_000922099.1 hypothetical protein -
  J4Q32_RS07125 (J4Q32_07135) - 1403992..1406070 (-) 2079 WP_050394897.1 DUF859 family phage minor structural protein -
  J4Q32_RS07130 (J4Q32_07140) - 1406081..1412248 (-) 6168 WP_233922949.1 phage tail protein -
  J4Q32_RS07135 (J4Q32_07145) - 1412250..1413764 (-) 1515 WP_000161550.1 distal tail protein Dit -
  J4Q32_RS07140 (J4Q32_07150) - 1413761..1417063 (-) 3303 WP_233922950.1 tape measure protein -
  J4Q32_RS07145 (J4Q32_07155) - 1417056..1417625 (-) 570 WP_000062050.1 Gp15 family bacteriophage protein -
  J4Q32_RS07150 (J4Q32_07160) - 1417638..1418126 (-) 489 WP_050216326.1 hypothetical protein -
  J4Q32_RS07155 (J4Q32_07165) - 1418191..1418640 (-) 450 WP_050198117.1 phage tail tube protein -
  J4Q32_RS07160 (J4Q32_07170) - 1418637..1419044 (-) 408 WP_001208881.1 minor capsid protein -
  J4Q32_RS07165 (J4Q32_07175) - 1419044..1419388 (-) 345 WP_050216327.1 minor capsid protein -
  J4Q32_RS07170 (J4Q32_07180) - 1419388..1419759 (-) 372 WP_000565934.1 putative minor capsid protein -
  J4Q32_RS07175 (J4Q32_07185) - 1419749..1420141 (-) 393 WP_233922951.1 hypothetical protein -
  J4Q32_RS07180 (J4Q32_07190) - 1420184..1420417 (-) 234 WP_001240344.1 hypothetical protein -
  J4Q32_RS07185 (J4Q32_07195) - 1420428..1421309 (-) 882 WP_050244669.1 hypothetical protein -
  J4Q32_RS07190 (J4Q32_07200) - 1421327..1421890 (-) 564 WP_000896122.1 phage scaffolding protein -
  J4Q32_RS07195 (J4Q32_07205) - 1422029..1423180 (-) 1152 WP_000730219.1 phage minor capsid protein -
  J4Q32_RS07200 (J4Q32_07210) - 1423294..1423665 (-) 372 WP_000401854.1 hypothetical protein -
  J4Q32_RS07205 (J4Q32_07215) - 1423692..1423940 (-) 249 WP_000170496.1 hypothetical protein -
  J4Q32_RS07210 (J4Q32_07220) - 1423927..1425495 (-) 1569 WP_057529818.1 phage portal protein -
  J4Q32_RS07215 (J4Q32_07225) - 1425508..1426818 (-) 1311 WP_233922952.1 PBSX family phage terminase large subunit -
  J4Q32_RS07220 (J4Q32_07230) - 1426808..1427263 (-) 456 WP_001136855.1 KGG domain-containing protein -
  J4Q32_RS07225 (J4Q32_07235) - 1427467..1428213 (-) 747 WP_000057535.1 hypothetical protein -
  J4Q32_RS07230 (J4Q32_07240) - 1428194..1429288 (-) 1095 WP_000425577.1 DUF4417 domain-containing protein -
  J4Q32_RS07235 (J4Q32_07245) - 1429354..1429746 (-) 393 WP_000162611.1 hypothetical protein -
  J4Q32_RS07240 (J4Q32_07250) - 1429746..1430039 (-) 294 WP_081571561.1 hypothetical protein -
  J4Q32_RS07245 (J4Q32_07255) - 1430133..1430339 (-) 207 WP_000573750.1 hypothetical protein -
  J4Q32_RS07250 (J4Q32_07260) - 1430341..1430742 (-) 402 WP_000667209.1 hypothetical protein -
  J4Q32_RS07255 (J4Q32_07265) - 1430753..1430965 (-) 213 WP_001286809.1 crAss001_48 related protein -
  J4Q32_RS07260 (J4Q32_07270) - 1430982..1431719 (-) 738 WP_061635780.1 hypothetical protein -
  J4Q32_RS07265 (J4Q32_07275) - 1431721..1432155 (-) 435 WP_000358622.1 hypothetical protein -
  J4Q32_RS07270 (J4Q32_07280) - 1432209..1432412 (-) 204 WP_000161128.1 hypothetical protein -
  J4Q32_RS07275 (J4Q32_07285) - 1432447..1433586 (-) 1140 WP_050085612.1 DNA cytosine methyltransferase -
  J4Q32_RS07280 (J4Q32_07290) ssb 1433612..1434187 (-) 576 WP_050091536.1 single-stranded DNA-binding protein Machinery gene
  J4Q32_RS07285 (J4Q32_07295) - 1434177..1434353 (-) 177 WP_001203349.1 hypothetical protein -
  J4Q32_RS07290 (J4Q32_07300) - 1434375..1435367 (-) 993 WP_001865202.1 DUF1351 domain-containing protein -
  J4Q32_RS07295 (J4Q32_07305) - 1435370..1436071 (-) 702 WP_000774580.1 ERF family protein -
  J4Q32_RS07300 (J4Q32_07310) - 1436077..1436529 (-) 453 WP_061745238.1 hypothetical protein -
  J4Q32_RS07305 (J4Q32_07315) - 1436612..1436878 (-) 267 WP_000450966.1 hypothetical protein -
  J4Q32_RS07310 (J4Q32_07320) - 1437035..1437391 (-) 357 WP_050116196.1 replication protein -
  J4Q32_RS07315 (J4Q32_07325) - 1437577..1438275 (-) 699 WP_023396067.1 phage antirepressor KilAC domain-containing protein -
  J4Q32_RS07320 (J4Q32_07330) - 1438277..1438462 (-) 186 WP_000638668.1 helix-turn-helix transcriptional regulator -
  J4Q32_RS07325 (J4Q32_07335) - 1438738..1439094 (+) 357 WP_000153672.1 helix-turn-helix domain-containing protein -
  J4Q32_RS07330 (J4Q32_07340) - 1439116..1439496 (+) 381 WP_000136430.1 ImmA/IrrE family metallo-endopeptidase -
  J4Q32_RS07335 (J4Q32_07345) - 1439510..1439860 (+) 351 WP_233922953.1 hypothetical protein -
  J4Q32_RS07340 (J4Q32_07350) - 1439979..1441106 (+) 1128 WP_000266839.1 site-specific integrase -
  J4Q32_RS07345 (J4Q32_07355) whiA 1441194..1442105 (-) 912 WP_000011306.1 DNA-binding protein WhiA -
  J4Q32_RS07350 (J4Q32_07360) - 1442102..1443079 (-) 978 WP_001231086.1 YvcK family protein -
  J4Q32_RS07355 (J4Q32_07365) rapZ 1443076..1443966 (-) 891 WP_000163033.1 RNase adapter RapZ -
  J4Q32_RS07360 (J4Q32_07370) - 1444018..1444398 (-) 381 WP_001140412.1 RidA family protein -
  J4Q32_RS07365 (J4Q32_07375) yihA 1444409..1444996 (-) 588 WP_000422599.1 ribosome biogenesis GTP-binding protein YihA/YsxC -
  J4Q32_RS07370 (J4Q32_07380) clpX 1445005..1446237 (-) 1233 WP_001814787.1 ATP-dependent Clp protease ATP-binding subunit ClpX Regulator
  J4Q32_RS07375 (J4Q32_07385) - 1446274..1446444 (-) 171 WP_000442260.1 hypothetical protein -
  J4Q32_RS07380 (J4Q32_07390) - 1446444..1446950 (-) 507 WP_000162475.1 dihydrofolate reductase -
  J4Q32_RS07385 (J4Q32_07395) - 1447082..1447600 (-) 519 WP_000229868.1 DNA starvation/stationary phase protection protein -
  J4Q32_RS07390 (J4Q32_07400) lytC 1448097..1449602 (-) 1506 WP_013193470.1 choline binding-anchored murein hydrolase LytC -
  J4Q32_RS07395 (J4Q32_07405) tpiA 1449640..1450398 (-) 759 WP_000087897.1 triose-phosphate isomerase -
  J4Q32_RS07400 (J4Q32_07410) - 1450497..1451174 (-) 678 WP_000221584.1 DnaD domain-containing protein -
  J4Q32_RS07405 (J4Q32_07415) metA 1451183..1452127 (-) 945 WP_001122708.1 homoserine O-succinyltransferase -
  J4Q32_RS07410 (J4Q32_07420) - 1452309..1452821 (-) 513 WP_001049323.1 adenine phosphoribosyltransferase -
  J4Q32_RS07415 (J4Q32_07425) - 1452908..1453666 (-) 759 WP_001287224.1 class I SAM-dependent methyltransferase -
  J4Q32_RS07420 (J4Q32_07430) - 1453874..1454020 (+) 147 WP_001821381.1 hypothetical protein -
  J4Q32_RS07425 (J4Q32_07435) - 1454167..1455297 (-) 1131 WP_000229959.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 410 a.a.        Molecular weight: 45725.30 Da        Isoelectric Point: 4.4775

>NTDB_id=548951 J4Q32_RS07370 WP_001814787.1 1445005..1446237(-) (clpX) [Streptococcus pneumoniae strain 19A-19087]
MPTTRNNDMMVYCSFCGKSQEEVQKIIAGNNAFICNECVELAQEIIREELAEEVLADLSEVPKPIELLHILNHYVIGQDR
AKRALAVAVYNHYKRINFHDTREESEDVDLQKSNILMIGPTGSGKTFLAQTLAKSLNVPFAIADATALTEAGYVGEDVEN
ILLKLLQVADFNIERAERGIIYVDEIDKIAKKSENVSITRDVSGEGVQQALLKIIEGTVASVPPQGGRKHPQQEMIQVDT
KNILFIVGGAFDGIEEIVKQRLGEKVIGFGQNNKAIDENSSYMQEIIAEDIQKFGIIPELIGRLPVFAALEQLTVDDLVR
ILKEPRNALVKQYQTLLSYDDVELKFDDEALQEIANKAIERKTGARGLRSIIEETMLDVMFEVPSQENVKLVRITKETVD
GTDKPILETA

Nucleotide


Download         Length: 1233 bp        

>NTDB_id=548951 J4Q32_RS07370 WP_001814787.1 1445005..1446237(-) (clpX) [Streptococcus pneumoniae strain 19A-19087]
ATGCCTACAACTAGGAATAATGATATGATGGTTTATTGCTCATTTTGTGGCAAAAGCCAAGAAGAAGTACAAAAAATAAT
CGCAGGGAACAACGCCTTTATCTGTAATGAATGTGTGGAGTTAGCCCAGGAAATCATTCGTGAGGAGTTGGCTGAGGAAG
TTTTGGCAGACTTGTCTGAAGTTCCAAAACCAATCGAACTTCTCCATATCTTGAACCACTATGTAATCGGTCAAGATCGT
GCCAAACGGGCCTTAGCAGTGGCGGTTTACAACCACTACAAACGCATCAATTTCCACGATACGCGTGAAGAGTCAGAAGA
TGTGGATTTGCAGAAGTCAAACATCTTGATGATTGGCCCAACTGGTTCAGGGAAAACTTTCCTTGCTCAGACCTTGGCTA
AGAGCTTGAATGTACCTTTTGCTATTGCGGATGCGACAGCTCTGACGGAGGCTGGTTATGTGGGTGAGGATGTGGAAAAT
ATCCTTCTCAAACTCTTGCAGGTTGCTGACTTTAACATCGAACGTGCAGAGCGTGGCATTATCTATGTGGATGAAATTGA
CAAGATTGCCAAGAAGAGTGAGAATGTGTCTATCACACGTGATGTTTCTGGTGAAGGGGTGCAACAAGCCCTTCTCAAGA
TTATCGAGGGAACTGTTGCTAGCGTGCCGCCTCAAGGTGGACGCAAACATCCACAACAAGAGATGATTCAAGTGGATACA
AAAAATATCCTCTTCATCGTGGGTGGTGCTTTTGATGGTATTGAAGAAATTGTCAAACAACGTCTGGGTGAAAAAGTCAT
CGGATTTGGTCAAAACAATAAGGCGATTGACGAAAACAGCTCATACATGCAAGAAATCATCGCTGAAGACATTCAAAAAT
TTGGTATTATCCCTGAGTTGATTGGACGCTTGCCTGTTTTTGCGGCTCTTGAGCAATTGACCGTTGATGACTTGGTTCGC
ATCTTGAAAGAGCCAAGAAATGCCTTGGTGAAACAATACCAAACCTTGCTTTCTTATGATGATGTTGAGTTGAAATTTGA
CGACGAAGCCCTTCAAGAGATTGCTAATAAAGCAATCGAACGGAAGACAGGGGCGCGTGGACTTCGCTCCATTATCGAAG
AAACCATGCTAGATGTTATGTTTGAGGTGCCGAGTCAGGAAAATGTGAAATTGGTTCGCATCACTAAAGAAACTGTCGAT
GGAACGGATAAACCGATCCTAGAAACAGCCTAG

Domains

Predicted by InterproScan.

ClpX C4-type zinc finger (zf-C4_ClpX)

(12-48)

C-terminal, D2-small domain, of ClpB protein (ClpB_D2-small)

(313-390)

AAA domain (Cdc48 subfamily) (AAA_2)

(111-306)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  clpX Streptococcus mutans UA159

86.098

100

0.861
  clpX Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819

57.463

98.049

0.563