Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   JS609_RS16230 Genome accession   NZ_CP071043
Coordinates   3124783..3124923 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis isolate ELA2001105     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3119783..3129923
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JS609_RS16205 (JS609_03192) yuxO 3120133..3120513 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  JS609_RS16210 (JS609_03193) comA 3120532..3121176 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  JS609_RS16215 (JS609_03194) comP 3121257..3123554 (-) 2298 WP_153912412.1 histidine kinase Regulator
  JS609_RS16220 (JS609_03195) comX 3123562..3123723 (-) 162 WP_049140565.1 competence pheromone ComX -
  JS609_RS16225 (JS609_03196) - 3123738..3124598 (-) 861 WP_040081966.1 polyprenyl synthetase family protein -
  JS609_RS16230 (JS609_03197) degQ 3124783..3124923 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  JS609_RS16235 - 3125145..3125270 (+) 126 WP_121549029.1 hypothetical protein -
  JS609_RS16240 (JS609_03198) - 3125384..3125752 (+) 369 WP_213414936.1 hypothetical protein -
  JS609_RS16245 (JS609_03199) pdeH 3125728..3126957 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  JS609_RS16250 (JS609_03200) pncB 3127094..3128566 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  JS609_RS16255 (JS609_03201) pncA 3128582..3129133 (-) 552 WP_015714627.1 cysteine hydrolase family protein -
  JS609_RS16260 (JS609_03202) yueI 3129230..3129628 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=542539 JS609_RS16230 WP_003220708.1 3124783..3124923(-) (degQ) [Bacillus subtilis isolate ELA2001105]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=542539 JS609_RS16230 WP_003220708.1 3124783..3124923(-) (degQ) [Bacillus subtilis isolate ELA2001105]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1