Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   JYG31_RS16765 Genome accession   NZ_CP070976
Coordinates   3244163..3244303 (-) Length   46 a.a.
NCBI ID   WP_024122683.1    Uniprot ID   A0A9Q4HP57
Organism   Bacillus halotolerans strain MBH1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3239163..3249303
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JYG31_RS16740 (JYG31_16740) - 3239474..3239854 (-) 381 WP_044158943.1 hotdog fold thioesterase -
  JYG31_RS16745 (JYG31_16745) comA 3239872..3240516 (-) 645 WP_101864137.1 two-component system response regulator ComA Regulator
  JYG31_RS16750 (JYG31_16750) comP 3240597..3242906 (-) 2310 WP_213417883.1 two-component system sensor histidine kinase ComP Regulator
  JYG31_RS16755 (JYG31_16755) comX 3242922..3243089 (-) 168 WP_044158946.1 competence pheromone ComX Regulator
  JYG31_RS16760 (JYG31_16760) comQ 3243073..3243978 (-) 906 WP_213418755.1 polyprenyl synthetase family protein Regulator
  JYG31_RS16765 (JYG31_16765) degQ 3244163..3244303 (-) 141 WP_024122683.1 degradation enzyme regulation protein DegQ Regulator
  JYG31_RS16770 (JYG31_16770) - 3244764..3245132 (+) 369 WP_103671364.1 hypothetical protein -
  JYG31_RS16775 (JYG31_16775) - 3245108..3246337 (-) 1230 WP_044158949.1 EAL and HDOD domain-containing protein -
  JYG31_RS16780 (JYG31_16780) - 3246473..3247942 (-) 1470 WP_024122686.1 nicotinate phosphoribosyltransferase -
  JYG31_RS16785 (JYG31_16785) - 3247958..3248509 (-) 552 WP_213417885.1 isochorismatase family cysteine hydrolase -
  JYG31_RS16790 (JYG31_16790) - 3248606..3249004 (-) 399 WP_095713979.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5533.44 Da        Isoelectric Point: 6.2559

>NTDB_id=541762 JYG31_RS16765 WP_024122683.1 3244163..3244303(-) (degQ) [Bacillus halotolerans strain MBH1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYTYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=541762 JYG31_RS16765 WP_024122683.1 3244163..3244303(-) (degQ) [Bacillus halotolerans strain MBH1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACACATACGCAATGAAAATTTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

97.826

100

0.978