Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   JSQ81_RS07640 Genome accession   NZ_CP070502
Coordinates   1493963..1494436 (-) Length   157 a.a.
NCBI ID   WP_212607063.1    Uniprot ID   A0A975QBP7
Organism   Sporosarcina sp. Marseille-Q4063     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1493963..1532988 1493963..1494436 within 0


Gene organization within MGE regions


Location: 1493963..1532988
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JSQ81_RS07640 (JSQ81_07640) ssbA 1493963..1494436 (-) 474 WP_212607063.1 single-stranded DNA-binding protein Machinery gene
  JSQ81_RS07645 (JSQ81_07645) - 1494509..1495294 (-) 786 WP_212607064.1 hypothetical protein -
  JSQ81_RS07650 (JSQ81_07650) - 1495297..1496589 (-) 1293 WP_212607065.1 RecT family recombinase -
  JSQ81_RS07655 (JSQ81_07655) - 1497248..1498162 (-) 915 WP_212607066.1 HNH endonuclease -
  JSQ81_RS07660 (JSQ81_07660) - 1498238..1498975 (-) 738 WP_212607067.1 hypothetical protein -
  JSQ81_RS07665 (JSQ81_07665) - 1499042..1499863 (-) 822 WP_249336672.1 S1 RNA-binding domain-containing protein -
  JSQ81_RS07670 (JSQ81_07670) - 1499926..1501605 (-) 1680 WP_249336673.1 type IV secretory system conjugative DNA transfer family protein -
  JSQ81_RS07675 (JSQ81_07675) - 1501627..1502040 (-) 414 WP_212607069.1 hypothetical protein -
  JSQ81_RS07680 (JSQ81_07680) - 1502198..1503382 (-) 1185 WP_212607070.1 DUF6575 domain-containing protein -
  JSQ81_RS07685 (JSQ81_07685) - 1503389..1503787 (-) 399 WP_212607071.1 hypothetical protein -
  JSQ81_RS07690 (JSQ81_07690) - 1503922..1504359 (-) 438 WP_212607072.1 hypothetical protein -
  JSQ81_RS07695 (JSQ81_07695) - 1504422..1504628 (-) 207 WP_212607073.1 hypothetical protein -
  JSQ81_RS07700 (JSQ81_07700) - 1504708..1505757 (-) 1050 WP_212607074.1 replication-relaxation family protein -
  JSQ81_RS07705 (JSQ81_07705) - 1506036..1506737 (-) 702 WP_212607075.1 hypothetical protein -
  JSQ81_RS07710 (JSQ81_07710) - 1507021..1508046 (-) 1026 WP_212607076.1 peptidoglycan DD-metalloendopeptidase family protein -
  JSQ81_RS07715 (JSQ81_07715) - 1508101..1508838 (-) 738 WP_212607077.1 hypothetical protein -
  JSQ81_RS07720 (JSQ81_07720) - 1508892..1511417 (-) 2526 WP_371812524.1 CD3337/EF1877 family mobilome membrane protein -
  JSQ81_RS07725 (JSQ81_07725) - 1511478..1512023 (-) 546 WP_212607079.1 hypothetical protein -
  JSQ81_RS07730 (JSQ81_07730) - 1512056..1514644 (-) 2589 WP_212607080.1 ATP-binding protein -
  JSQ81_RS07735 (JSQ81_07735) - 1514841..1515527 (-) 687 WP_212607081.1 TcpE family conjugal transfer membrane protein -
  JSQ81_RS07740 (JSQ81_07740) - 1515637..1515858 (-) 222 WP_099670960.1 hypothetical protein -
  JSQ81_RS07745 (JSQ81_07745) - 1515950..1517098 (-) 1149 WP_212607082.1 conjugal transfer protein -
  JSQ81_RS07750 (JSQ81_07750) - 1517149..1517370 (-) 222 WP_212607083.1 hypothetical protein -
  JSQ81_RS07755 (JSQ81_07755) - 1517434..1518129 (-) 696 WP_212607084.1 hypothetical protein -
  JSQ81_RS07760 (JSQ81_07760) - 1518148..1518591 (-) 444 WP_212607085.1 DUF5348 domain-containing protein -
  JSQ81_RS07765 (JSQ81_07765) - 1518609..1518983 (-) 375 WP_212604604.1 hypothetical protein -
  JSQ81_RS07770 (JSQ81_07770) - 1519002..1519370 (-) 369 WP_212607086.1 hypothetical protein -
  JSQ81_RS07775 (JSQ81_07775) - 1519372..1520433 (-) 1062 WP_212607087.1 ParM/StbA family protein -
  JSQ81_RS07780 (JSQ81_07780) - 1520453..1520905 (-) 453 WP_212607088.1 metal-dependent hydrolase -
  JSQ81_RS07785 (JSQ81_07785) - 1522104..1522751 (-) 648 WP_212607089.1 helix-turn-helix domain-containing protein -
  JSQ81_RS07790 (JSQ81_07790) - 1522753..1524969 (-) 2217 WP_212607090.1 ATP-dependent RecD-like DNA helicase -
  JSQ81_RS07795 (JSQ81_07795) - 1524966..1525895 (-) 930 WP_212607091.1 transcription termination/antitermination NusG family protein -
  JSQ81_RS07800 (JSQ81_07800) - 1525975..1526295 (-) 321 WP_212607092.1 DUF771 domain-containing protein -
  JSQ81_RS07805 (JSQ81_07805) - 1526353..1526553 (-) 201 WP_212607093.1 helix-turn-helix domain-containing protein -
  JSQ81_RS07810 (JSQ81_07810) - 1526727..1527080 (+) 354 WP_212607094.1 helix-turn-helix domain-containing protein -
  JSQ81_RS07815 (JSQ81_07815) - 1527202..1527705 (+) 504 WP_212607095.1 ImmA/IrrE family metallo-endopeptidase -
  JSQ81_RS07820 (JSQ81_07820) - 1527733..1528845 (+) 1113 WP_212607096.1 tyrosine-type recombinase/integrase -
  JSQ81_RS07830 (JSQ81_07830) clpP 1529211..1529810 (+) 600 WP_305849488.1 ATP-dependent Clp endopeptidase proteolytic subunit ClpP -
  JSQ81_RS07840 (JSQ81_07840) - 1531754..1532011 (-) 258 WP_212607098.1 HPr family phosphocarrier protein -
  JSQ81_RS07845 (JSQ81_07845) whiA 1532041..1532988 (-) 948 WP_212607099.1 DNA-binding protein WhiA -

Sequence


Protein


Download         Length: 157 a.a.        Molecular weight: 17263.99 Da        Isoelectric Point: 7.1646

>NTDB_id=540259 JSQ81_RS07640 WP_212607063.1 1493963..1494436(-) (ssbA) [Sporosarcina sp. Marseille-Q4063]
MNNVSLVGRLTKEPTLKFTQNGVAVCNFTLAVNRPFKNANGENEADFIMVQVWRKPAENAANFLKKGSQAAVSGRINSRH
YENDKGDRIYVTEVVADFVQFLDPKPQGQGNQQQQGQGSYQKQPNPYAGNSNAQNQNSNHFETGGGSIAVSDDELPF

Nucleotide


Download         Length: 474 bp        

>NTDB_id=540259 JSQ81_RS07640 WP_212607063.1 1493963..1494436(-) (ssbA) [Sporosarcina sp. Marseille-Q4063]
ATGAATAACGTTAGCTTAGTAGGACGTTTAACAAAAGAACCAACACTTAAATTTACACAAAATGGTGTTGCTGTTTGCAA
CTTTACATTAGCTGTGAATCGTCCGTTTAAAAATGCTAATGGTGAAAATGAAGCGGATTTCATCATGGTACAGGTTTGGA
GGAAGCCTGCTGAAAATGCGGCAAACTTCCTTAAAAAAGGTAGTCAGGCCGCTGTCAGTGGAAGAATTAATAGTCGGCAT
TATGAAAATGATAAAGGGGATCGTATATATGTTACAGAGGTTGTAGCTGACTTTGTACAGTTCTTGGACCCGAAACCACA
AGGTCAAGGCAATCAACAACAGCAAGGACAGGGGAGCTACCAGAAACAACCGAATCCGTATGCTGGTAACAGTAATGCTC
AAAATCAAAATAGTAATCACTTCGAAACGGGTGGAGGTTCTATTGCAGTAAGCGATGATGAACTGCCGTTTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

49.123

100

0.535

  ssb Latilactobacillus sakei subsp. sakei 23K

46.154

100

0.497

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.516

0.401