Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   LL045_RS11390 Genome accession   NZ_CP086083
Coordinates   2315887..2316162 (-) Length   91 a.a.
NCBI ID   WP_021721873.1    Uniprot ID   -
Organism   Lactococcus lactis subsp. lactis strain EIP20A     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2310887..2321162
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LL045_RS11360 (LL045_11330) - 2311328..2311705 (-) 378 WP_021723060.1 pyridoxamine 5'-phosphate oxidase family protein -
  LL045_RS11365 (LL045_11335) - 2311909..2312775 (+) 867 WP_394530217.1 RluA family pseudouridine synthase -
  LL045_RS11370 (LL045_11340) - 2312813..2313622 (-) 810 WP_038602349.1 metal ABC transporter permease -
  LL045_RS11375 (LL045_11345) - 2313615..2314352 (-) 738 WP_021723055.1 metal ABC transporter ATP-binding protein -
  LL045_RS11380 (LL045_11350) - 2314530..2315372 (-) 843 WP_038602352.1 metal ABC transporter substrate-binding protein -
  LL045_RS11385 (LL045_11355) - 2315369..2315806 (-) 438 WP_021721874.1 zinc-dependent MarR family transcriptional regulator -
  LL045_RS11390 (LL045_11360) comGG 2315887..2316162 (-) 276 WP_021721873.1 hypothetical protein Machinery gene
  LL045_RS11395 (LL045_11365) comGF 2316210..2316656 (-) 447 WP_021721872.1 competence type IV pilus minor pilin ComGF Machinery gene
  LL045_RS11400 (LL045_11370) comGE 2316619..2316915 (-) 297 WP_038602356.1 competence type IV pilus minor pilin ComGE Machinery gene
  LL045_RS11405 (LL045_11375) comGD 2316887..2317318 (-) 432 WP_080651959.1 competence type IV pilus minor pilin ComGD Machinery gene
  LL045_RS11410 (LL045_11380) comGC 2317278..2317661 (-) 384 WP_080651958.1 competence type IV pilus major pilin ComGC Machinery gene
  LL045_RS11415 (LL045_11385) comGB 2317675..2318748 (-) 1074 WP_394530628.1 competence type IV pilus assembly protein ComGB Machinery gene
  LL045_RS11420 (LL045_11390) comGA 2318642..2319580 (-) 939 WP_394530221.1 competence type IV pilus ATPase ComGA Machinery gene

Sequence


Protein


Download         Length: 91 a.a.        Molecular weight: 10539.79 Da        Isoelectric Point: 5.6623

>NTDB_id=540225 LL045_RS11390 WP_021721873.1 2315887..2316162(-) (comGG) [Lactococcus lactis subsp. lactis strain EIP20A]
MFLQFYLQRQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLFYNLLTDSSASSKTTDHLSDEKTYQFSIR
LKDGTNFQIKN

Nucleotide


Download         Length: 276 bp        

>NTDB_id=540225 LL045_RS11390 WP_021721873.1 2315887..2316162(-) (comGG) [Lactococcus lactis subsp. lactis strain EIP20A]
ATGTTTCTTCAGTTCTATTTGCAAAGACAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTTAACTGCTGA
ATTAATGGTGTCAGTAGCTTTAAAGACTGACTTAAAATCTCAAGGGCAAATTCATTTTGATTCAGGAGATTTGTTCTACA
ATTTACTGACAGACTCGTCAGCCAGTTCAAAAACTACTGATCATTTAAGCGATGAAAAAACTTATCAATTTAGTATCCGC
CTAAAAGATGGCACAAACTTTCAAATAAAAAATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

61.111

98.901

0.604