Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGD   Type   Machinery gene
Locus tag   LLUL021_RS11510 Genome accession   NZ_CP070263
Coordinates   2264176..2264607 (-) Length   143 a.a.
NCBI ID   WP_080585155.1    Uniprot ID   -
Organism   Lactococcus lactis subsp. lactis strain UL021     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2258621..2301033 2264176..2264607 within 0


Gene organization within MGE regions


Location: 2258621..2301033
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLUL021_RS11475 (LLUL021_11435) - 2260094..2260903 (-) 810 WP_014570791.1 metal ABC transporter permease -
  LLUL021_RS11480 (LLUL021_11440) - 2260896..2261633 (-) 738 WP_058221575.1 metal ABC transporter ATP-binding protein -
  LLUL021_RS11485 (LLUL021_11445) - 2261810..2262652 (-) 843 WP_003129990.1 metal ABC transporter substrate-binding protein -
  LLUL021_RS11490 (LLUL021_11450) - 2262649..2263086 (-) 438 WP_003129992.1 zinc-dependent MarR family transcriptional regulator -
  LLUL021_RS11495 (LLUL021_11455) comGG 2263176..2263460 (-) 285 WP_003129993.1 competence type IV pilus minor pilin ComGG Machinery gene
  LLUL021_RS11500 (LLUL021_11460) comGF 2263499..2263945 (-) 447 WP_029344525.1 competence type IV pilus minor pilin ComGF Machinery gene
  LLUL021_RS11505 (LLUL021_11465) comGE 2263908..2264204 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  LLUL021_RS11510 (LLUL021_11470) comGD 2264176..2264607 (-) 432 WP_080585155.1 competence type IV pilus minor pilin ComGD Machinery gene
  LLUL021_RS11515 (LLUL021_11475) comGC 2264567..2264863 (-) 297 WP_212715809.1 competence type IV pilus major pilin ComGC Machinery gene
  LLUL021_RS11520 (LLUL021_11480) - 2265025..2265804 (-) 780 WP_137016631.1 peptidoglycan amidohydrolase family protein -
  LLUL021_RS11525 (LLUL021_11485) - 2265804..2266091 (-) 288 WP_137016629.1 phage holin -
  LLUL021_RS11530 (LLUL021_11490) - 2266104..2266454 (-) 351 WP_014570798.1 hypothetical protein -
  LLUL021_RS11535 (LLUL021_11495) - 2266467..2266703 (-) 237 WP_137016624.1 hypothetical protein -
  LLUL021_RS11540 (LLUL021_14250) - 2266715..2271607 (-) 4893 WP_262652020.1 phage tail protein -
  LLUL021_RS11545 (LLUL021_11510) - 2271586..2273115 (-) 1530 WP_137016568.1 distal tail protein Dit -
  LLUL021_RS11550 (LLUL021_11515) - 2273125..2275185 (-) 2061 WP_212715806.1 phage tail tape measure protein -
  LLUL021_RS11555 (LLUL021_11520) - 2275404..2275964 (-) 561 WP_137016566.1 HNH endonuclease -
  LLUL021_RS11560 (LLUL021_11525) - 2276135..2276662 (-) 528 Protein_2252 phage tail tape measure protein -
  LLUL021_RS11565 (LLUL021_11530) - 2276652..2277359 (-) 708 WP_137016561.1 Gp15 family bacteriophage protein -
  LLUL021_RS11570 (LLUL021_11535) - 2277375..2277782 (-) 408 WP_003131323.1 hypothetical protein -
  LLUL021_RS11575 (LLUL021_11540) - 2277839..2278315 (-) 477 WP_014570559.1 phage tail tube protein -
  LLUL021_RS11580 (LLUL021_11545) - 2278326..2278760 (-) 435 WP_003131321.1 minor capsid protein -
  LLUL021_RS11585 (LLUL021_11550) - 2278760..2279089 (-) 330 WP_003131320.1 hypothetical protein -
  LLUL021_RS11590 (LLUL021_11555) - 2279086..2279430 (-) 345 WP_003131319.1 putative minor capsid protein -
  LLUL021_RS11595 (LLUL021_11560) - 2279420..2279821 (-) 402 WP_014570556.1 hypothetical protein -
  LLUL021_RS11600 (LLUL021_11565) - 2279895..2280131 (-) 237 WP_014570555.1 Ig-like domain-containing protein -
  LLUL021_RS11605 (LLUL021_11570) - 2280160..2281077 (-) 918 WP_003131315.1 hypothetical protein -
  LLUL021_RS11610 (LLUL021_11575) - 2281092..2282144 (-) 1053 WP_137016559.1 XkdF-like putative serine protease domain-containing protein -
  LLUL021_RS11615 (LLUL021_11580) - 2282160..2282990 (-) 831 WP_029344323.1 phage minor head protein -
  LLUL021_RS11620 (LLUL021_11585) - 2282983..2284512 (-) 1530 WP_137016556.1 phage portal protein -
  LLUL021_RS11625 (LLUL021_11590) terL 2284525..2285976 (-) 1452 WP_170959164.1 phage terminase large subunit -
  LLUL021_RS11630 (LLUL021_11595) - 2285957..2286430 (-) 474 WP_137016554.1 helix-turn-helix domain-containing protein -
  LLUL021_RS11635 (LLUL021_11600) - 2286708..2287133 (-) 426 WP_058203511.1 RinA family protein -
  LLUL021_RS11640 (LLUL021_14255) - 2287304..2287438 (+) 135 WP_160257223.1 MucR family transcriptional regulator -
  LLUL021_RS11645 (LLUL021_11605) - 2287626..2287811 (-) 186 WP_058212988.1 hypothetical protein -
  LLUL021_RS11650 (LLUL021_11610) - 2287808..2287993 (-) 186 WP_137016552.1 hypothetical protein -
  LLUL021_RS11655 (LLUL021_11615) - 2288001..2288186 (-) 186 WP_137016550.1 DUF1660 domain-containing protein -
  LLUL021_RS11660 (LLUL021_11620) - 2288183..2288422 (-) 240 WP_137016548.1 hypothetical protein -
  LLUL021_RS11665 (LLUL021_11625) - 2288469..2289161 (-) 693 WP_262652026.1 hypothetical protein -
  LLUL021_RS11670 (LLUL021_11630) - 2289151..2289492 (-) 342 WP_249351733.1 hypothetical protein -
  LLUL021_RS11675 (LLUL021_14260) - 2289626..2290159 (-) 534 WP_249351731.1 hypothetical protein -
  LLUL021_RS11680 (LLUL021_11645) - 2290162..2290581 (-) 420 WP_011834789.1 dUTP diphosphatase -
  LLUL021_RS11685 (LLUL021_11650) - 2290578..2290886 (-) 309 WP_137016131.1 hypothetical protein -
  LLUL021_RS11690 (LLUL021_11655) - 2290883..2291401 (-) 519 WP_137016129.1 DUF1642 domain-containing protein -
  LLUL021_RS11695 (LLUL021_11660) - 2291398..2291679 (-) 282 WP_137016127.1 hypothetical protein -
  LLUL021_RS11700 (LLUL021_11665) - 2291691..2291966 (-) 276 WP_014570536.1 hypothetical protein -
  LLUL021_RS11705 (LLUL021_11670) - 2291975..2292181 (-) 207 WP_137016125.1 hypothetical protein -
  LLUL021_RS11710 (LLUL021_11675) - 2292202..2292465 (-) 264 WP_137016123.1 hypothetical protein -
  LLUL021_RS11715 (LLUL021_11680) - 2292575..2292814 (-) 240 WP_031560849.1 DUF1031 family protein -
  LLUL021_RS11720 (LLUL021_11685) - 2292817..2293206 (-) 390 WP_262652031.1 RusA family crossover junction endodeoxyribonuclease -
  LLUL021_RS11725 (LLUL021_11690) - 2293196..2293468 (-) 273 WP_262652032.1 hypothetical protein -
  LLUL021_RS11730 (LLUL021_11695) - 2293452..2294258 (-) 807 WP_283657081.1 helix-turn-helix domain-containing protein -
  LLUL021_RS11735 (LLUL021_11700) - 2294487..2295401 (-) 915 WP_249351729.1 AAA family ATPase -
  LLUL021_RS11740 (LLUL021_11705) - 2295401..2296207 (-) 807 WP_137016115.1 PD-(D/E)XK nuclease-like domain-containing protein -
  LLUL021_RS11745 (LLUL021_11710) - 2296310..2296558 (-) 249 WP_137016113.1 hypothetical protein -
  LLUL021_RS11750 (LLUL021_14265) - 2296571..2296693 (-) 123 WP_023164646.1 hypothetical protein -
  LLUL021_RS11755 (LLUL021_11715) - 2296690..2296872 (-) 183 WP_137016111.1 hypothetical protein -
  LLUL021_RS11760 (LLUL021_11720) - 2296888..2297601 (-) 714 WP_249351727.1 antA/AntB antirepressor family protein -
  LLUL021_RS11765 (LLUL021_11725) - 2297657..2297866 (-) 210 WP_023164648.1 helix-turn-helix transcriptional regulator -
  LLUL021_RS11770 (LLUL021_11730) - 2298059..2298484 (+) 426 WP_023164649.1 helix-turn-helix transcriptional regulator -
  LLUL021_RS11775 (LLUL021_11735) - 2298495..2299079 (+) 585 WP_058212856.1 hypothetical protein -
  LLUL021_RS11780 (LLUL021_11740) - 2299138..2299431 (+) 294 WP_032947831.1 hypothetical protein -
  LLUL021_RS11785 (LLUL021_11745) - 2299576..2301033 (+) 1458 WP_137016107.1 recombinase family protein -

Sequence

Protein


Download         Length: 143 a.a.        Molecular weight: 16534.53 Da        Isoelectric Point: 9.6891

>NTDB_id=538906 LLUL021_RS11510 WP_080585155.1 2264176..2264607(-) (comGD) [Lactococcus lactis subsp. lactis strain UL021]
MIRTKMKNEILMTRAFTLLESLLVLLIISFITTLFSLEIIQTVHLFKGELFVLQFENFYKRSQEDAALLQKSESLVAKNQ
ELICEDRSITIPKEVAVKDFTVKFDDKGGNSSLQKLTIFLPYEKKFITYQLEIGSGKFKKKIS

Nucleotide


Download         Length: 432 bp        

>NTDB_id=538906 LLUL021_RS11510 WP_080585155.1 2264176..2264607(-) (comGD) [Lactococcus lactis subsp. lactis strain UL021]
ATGATCAGAACAAAAATGAAGAACGAAATTTTAATGACTAGAGCATTTACTTTACTAGAGTCTCTTCTAGTTTTGTTGAT
TATTTCTTTTATCACAACTCTTTTTTCTTTAGAAATAATACAAACAGTCCATCTTTTTAAGGGAGAACTGTTTGTTCTCC
AGTTTGAAAATTTCTATAAAAGGAGTCAAGAAGATGCTGCACTGCTTCAAAAATCTGAAAGTTTAGTTGCTAAAAATCAA
GAATTAATCTGTGAAGATAGAAGTATCACAATTCCAAAGGAGGTAGCAGTTAAAGATTTTACAGTTAAATTTGATGATAA
GGGAGGGAATTCTAGCTTACAAAAACTCACAATTTTTTTACCTTACGAAAAAAAGTTCATCACTTATCAATTGGAGATAG
GCAGTGGAAAATTTAAAAAGAAAATCAGTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Lactococcus lactis subsp. cremoris KW2

66.434

100

0.664
  comYD Streptococcus gordonii str. Challis substr. CH1

39.716

98.601

0.392
  comYD Streptococcus mutans UA140

40.625

89.51

0.364
  comYD Streptococcus mutans UA159

40.625

89.51

0.364