Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   JR311_RS12515 Genome accession   NZ_CP069391
Coordinates   2608265..2608702 (-) Length   145 a.a.
NCBI ID   WP_007612572.1    Uniprot ID   -
Organism   Bacillus velezensis strain Sam8H1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2603265..2613702
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JR311_RS12465 (JR311_12465) sinI 2603651..2603824 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  JR311_RS12470 (JR311_12470) sinR 2603858..2604193 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  JR311_RS12475 (JR311_12475) tasA 2604241..2605026 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  JR311_RS12480 (JR311_12480) sipW 2605090..2605674 (-) 585 WP_012117977.1 signal peptidase I SipW -
  JR311_RS12485 (JR311_12485) tapA 2605646..2606316 (-) 671 Protein_2426 amyloid fiber anchoring/assembly protein TapA -
  JR311_RS12490 (JR311_12490) - 2606575..2606904 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  JR311_RS12495 (JR311_12495) - 2606944..2607123 (-) 180 WP_003153093.1 YqzE family protein -
  JR311_RS12500 (JR311_12500) comGG 2607180..2607557 (-) 378 WP_094247734.1 competence type IV pilus minor pilin ComGG Machinery gene
  JR311_RS12505 (JR311_12505) comGF 2607558..2608058 (-) 501 WP_014305411.1 competence type IV pilus minor pilin ComGF -
  JR311_RS12510 (JR311_12510) comGE 2607967..2608281 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  JR311_RS12515 (JR311_12515) comGD 2608265..2608702 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  JR311_RS12520 (JR311_12520) comGC 2608692..2609000 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  JR311_RS12525 (JR311_12525) comGB 2609005..2610042 (-) 1038 WP_003153086.1 competence type IV pilus assembly protein ComGB Machinery gene
  JR311_RS12530 (JR311_12530) comGA 2610029..2611099 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  JR311_RS12535 (JR311_12535) - 2611291..2612241 (-) 951 WP_204529786.1 magnesium transporter CorA family protein -
  JR311_RS12540 (JR311_12540) - 2612387..2613688 (+) 1302 WP_070082114.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16254.76 Da        Isoelectric Point: 10.1850

>NTDB_id=534381 JR311_RS12515 WP_007612572.1 2608265..2608702(-) (comGD) [Bacillus velezensis strain Sam8H1]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=534381 JR311_RS12515 WP_007612572.1 2608265..2608702(-) (comGD) [Bacillus velezensis strain Sam8H1]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTGACTTTACCAGAGAGCCTTGA
ATTTAATGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

55.479

100

0.559