Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   JR311_RS12465 Genome accession   NZ_CP069391
Coordinates   2603651..2603824 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain Sam8H1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2598651..2608824
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JR311_RS12450 (JR311_12450) gcvT 2599469..2600569 (-) 1101 WP_204529785.1 glycine cleavage system aminomethyltransferase GcvT -
  JR311_RS12455 (JR311_12455) - 2600992..2602662 (+) 1671 WP_060562612.1 DEAD/DEAH box helicase -
  JR311_RS12460 (JR311_12460) - 2602680..2603474 (+) 795 WP_060562613.1 YqhG family protein -
  JR311_RS12465 (JR311_12465) sinI 2603651..2603824 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  JR311_RS12470 (JR311_12470) sinR 2603858..2604193 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  JR311_RS12475 (JR311_12475) tasA 2604241..2605026 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  JR311_RS12480 (JR311_12480) sipW 2605090..2605674 (-) 585 WP_012117977.1 signal peptidase I SipW -
  JR311_RS12485 (JR311_12485) tapA 2605646..2606316 (-) 671 Protein_2426 amyloid fiber anchoring/assembly protein TapA -
  JR311_RS12490 (JR311_12490) - 2606575..2606904 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  JR311_RS12495 (JR311_12495) - 2606944..2607123 (-) 180 WP_003153093.1 YqzE family protein -
  JR311_RS12500 (JR311_12500) comGG 2607180..2607557 (-) 378 WP_094247734.1 competence type IV pilus minor pilin ComGG Machinery gene
  JR311_RS12505 (JR311_12505) comGF 2607558..2608058 (-) 501 WP_014305411.1 competence type IV pilus minor pilin ComGF -
  JR311_RS12510 (JR311_12510) comGE 2607967..2608281 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  JR311_RS12515 (JR311_12515) comGD 2608265..2608702 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=534377 JR311_RS12465 WP_003153105.1 2603651..2603824(+) (sinI) [Bacillus velezensis strain Sam8H1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=534377 JR311_RS12465 WP_003153105.1 2603651..2603824(+) (sinI) [Bacillus velezensis strain Sam8H1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCTCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702