Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   JOF24_RS14895 Genome accession   NZ_CP069214
Coordinates   3047659..3047799 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain GUAL210     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3042659..3052799
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JOF24_RS14870 - 3042966..3043349 (-) 384 WP_007408674.1 hotdog fold thioesterase -
  JOF24_RS14875 comA 3043371..3044015 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  JOF24_RS14880 - 3044096..3046394 (-) 2299 Protein_2889 histidine kinase -
  JOF24_RS14885 comX 3046414..3046590 (-) 177 WP_007408675.1 competence pheromone ComX -
  JOF24_RS14890 comQ 3046590..3047528 (-) 939 WP_020954300.1 polyprenyl synthetase family protein Regulator
  JOF24_RS14895 degQ 3047659..3047799 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  JOF24_RS14900 - 3048265..3048606 (+) 342 WP_015418107.1 hypothetical protein -
  JOF24_RS14905 - 3048613..3049836 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  JOF24_RS14910 - 3049966..3051432 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  JOF24_RS14915 - 3051450..3052001 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  JOF24_RS14920 - 3052098..3052496 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=532991 JOF24_RS14895 WP_003152043.1 3047659..3047799(-) (degQ) [Bacillus velezensis strain GUAL210]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=532991 JOF24_RS14895 WP_003152043.1 3047659..3047799(-) (degQ) [Bacillus velezensis strain GUAL210]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891