Detailed information    

insolico Bioinformatically predicted

Overview

Name   comK/comK1   Type   Regulator
Locus tag   JN168_RS09355 Genome accession   NZ_CP069082
Coordinates   1977615..1978178 (-) Length   187 a.a.
NCBI ID   WP_042739843.1    Uniprot ID   -
Organism   Staphylococcus gallinarum strain STP534     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1937335..1977109 1977615..1978178 flank 506


Gene organization within MGE regions


Location: 1937335..1978178
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JN168_RS09040 - 1937335..1938753 (-) 1419 WP_279525795.1 SH3 domain-containing protein -
  JN168_RS09045 - 1938753..1939064 (-) 312 WP_279526273.1 phage holin -
  JN168_RS09050 - 1939224..1939595 (-) 372 WP_232153929.1 DUF2951 family protein -
  JN168_RS09055 - 1939633..1939782 (-) 150 WP_279525796.1 XkdX family protein -
  JN168_RS09060 - 1939784..1940173 (-) 390 WP_119472648.1 hypothetical protein -
  JN168_RS09065 - 1940188..1941675 (-) 1488 WP_119472647.1 BppU family phage baseplate upper protein -
  JN168_RS09070 - 1941689..1944346 (-) 2658 WP_279525797.1 peptidase G2 autoproteolytic cleavage domain-containing protein -
  JN168_RS09075 - 1944363..1944827 (-) 465 WP_042738340.1 hypothetical protein -
  JN168_RS09080 - 1944820..1946406 (-) 1587 WP_279525798.1 prophage endopeptidase tail family protein -
  JN168_RS09085 - 1946416..1947243 (-) 828 WP_279525799.1 distal tail protein Dit -
  JN168_RS09090 - 1947245..1951600 (-) 4356 WP_279525800.1 peptidoglycan DD-metalloendopeptidase family protein -
  JN168_RS09095 - 1951630..1952148 (-) 519 WP_279526280.1 phage tail assembly chaperone GT -
  JN168_RS09100 - 1952164..1952523 (-) 360 WP_107590298.1 phage tail assembly chaperone G -
  JN168_RS09105 - 1952593..1952778 (-) 186 WP_107579406.1 hypothetical protein -
  JN168_RS09110 - 1952798..1953436 (-) 639 WP_107579405.1 major tail protein -
  JN168_RS09115 - 1953449..1953853 (-) 405 WP_107590300.1 hypothetical protein -
  JN168_RS09120 - 1953856..1954260 (-) 405 WP_107579403.1 hypothetical protein -
  JN168_RS09125 - 1954257..1954586 (-) 330 WP_107579402.1 hypothetical protein -
  JN168_RS09130 - 1954576..1954917 (-) 342 WP_279525801.1 head-tail connector protein -
  JN168_RS09135 - 1954936..1956291 (-) 1356 WP_279525802.1 phage major capsid protein -
  JN168_RS09140 - 1956330..1956887 (-) 558 WP_232165333.1 HK97 family phage prohead protease -
  JN168_RS09145 - 1956877..1958109 (-) 1233 WP_279525803.1 phage portal protein -
  JN168_RS09150 - 1958112..1958297 (-) 186 WP_279525804.1 hypothetical protein -
  JN168_RS09155 - 1958312..1960064 (-) 1753 Protein_1772 terminase TerL endonuclease subunit -
  JN168_RS09160 - 1960057..1960542 (-) 486 WP_107579395.1 phage terminase small subunit P27 family -
  JN168_RS09165 - 1960675..1961025 (-) 351 WP_107579394.1 HNH endonuclease -
  JN168_RS09170 - 1961565..1962011 (-) 447 WP_279525805.1 transcriptional regulator -
  JN168_RS09175 - 1962176..1962370 (-) 195 WP_279525806.1 transcriptional activator RinB -
  JN168_RS09180 - 1962367..1962531 (-) 165 WP_279525807.1 hypothetical protein -
  JN168_RS09185 - 1962531..1962983 (-) 453 WP_279525808.1 hypothetical protein -
  JN168_RS09190 - 1962986..1963138 (-) 153 WP_279525809.1 DUF1381 domain-containing protein -
  JN168_RS09195 - 1963143..1963319 (-) 177 WP_279525810.1 hypothetical protein -
  JN168_RS09200 - 1963369..1963878 (-) 510 WP_279526275.1 dUTP pyrophosphatase -
  JN168_RS09205 - 1963913..1964143 (-) 231 WP_279525811.1 hypothetical protein -
  JN168_RS09210 - 1964157..1964357 (-) 201 WP_042738316.1 hypothetical protein -
  JN168_RS09215 - 1964358..1964705 (-) 348 WP_042738315.1 hypothetical protein -
  JN168_RS09220 - 1964719..1964904 (-) 186 WP_126542119.1 hypothetical protein -
  JN168_RS09225 - 1964908..1965321 (-) 414 WP_042738313.1 hypothetical protein -
  JN168_RS09230 - 1965323..1965733 (-) 411 WP_279525813.1 hypothetical protein -
  JN168_RS09235 - 1965936..1966520 (-) 585 WP_279525814.1 DUF3310 domain-containing protein -
  JN168_RS09240 - 1966521..1966880 (-) 360 WP_279525815.1 SA1788 family PVL leukocidin-associated protein -
  JN168_RS09245 - 1966880..1967077 (-) 198 WP_279525816.1 hypothetical protein -
  JN168_RS09250 - 1967077..1967490 (-) 414 WP_279525817.1 YopX family protein -
  JN168_RS09255 - 1967497..1967901 (-) 405 WP_279525818.1 DUF1064 domain-containing protein -
  JN168_RS09260 - 1967912..1968085 (-) 174 WP_279525819.1 hypothetical protein -
  JN168_RS09265 - 1968049..1968297 (-) 249 WP_279525820.1 hypothetical protein -
  JN168_RS09270 - 1968294..1969544 (-) 1251 WP_279525821.1 DnaB-like helicase C-terminal domain-containing protein -
  JN168_RS09275 - 1969537..1969893 (-) 357 WP_107641481.1 hypothetical protein -
  JN168_RS09280 - 1969898..1970623 (-) 726 WP_279525822.1 conserved phage C-terminal domain-containing protein -
  JN168_RS09285 - 1970610..1971290 (-) 681 WP_279525823.1 putative HNHc nuclease -
  JN168_RS09290 ssbA 1971302..1971745 (-) 444 WP_279525824.1 single-stranded DNA-binding protein Machinery gene
  JN168_RS09295 - 1971748..1972368 (-) 621 WP_279525825.1 DUF1071 domain-containing protein -
  JN168_RS09300 - 1972361..1972585 (-) 225 WP_042738300.1 DUF2483 family protein -
  JN168_RS09305 - 1972830..1973153 (-) 324 WP_107641475.1 DUF771 domain-containing protein -
  JN168_RS09310 - 1973150..1973653 (-) 504 WP_279525826.1 hypothetical protein -
  JN168_RS09315 - 1973766..1973990 (-) 225 WP_279526276.1 DUF739 family protein -
  JN168_RS09320 - 1974153..1974557 (+) 405 WP_279525827.1 helix-turn-helix domain-containing protein -
  JN168_RS09325 - 1974559..1974996 (+) 438 WP_279525828.1 ImmA/IrrE family metallo-endopeptidase -
  JN168_RS09330 - 1975037..1975348 (+) 312 WP_279525829.1 hypothetical protein -
  JN168_RS09335 - 1975428..1975988 (+) 561 WP_279525830.1 hypothetical protein -
  JN168_RS09340 - 1976048..1977109 (+) 1062 WP_279525831.1 tyrosine-type recombinase/integrase -
  JN168_RS09355 comK/comK1 1977615..1978178 (-) 564 WP_042739843.1 competence protein ComK Regulator

Sequence

Protein


Download         Length: 187 a.a.        Molecular weight: 22020.37 Da        Isoelectric Point: 8.9339

>NTDB_id=532251 JN168_RS09355 WP_042739843.1 1977615..1978178(-) (comK/comK1) [Staphylococcus gallinarum strain STP534]
MNLHYVIKKGDMALQPCNVSFGLLEGTRVFKYKDECTVIKDRTPKIIDRSCRFYGSSYNFKKEDTMRITGISSKPPLLFT
PLFPTYFFPTHSDRKDENTWINIHYVEQIKPLKDKKCKVIFVDDQTITVNISAHSMHHQYLNGIYYYYMMDRAARVATFD
PDSPIDYTKPQLNIYEALAKYSLFEHK

Nucleotide


Download         Length: 564 bp        

>NTDB_id=532251 JN168_RS09355 WP_042739843.1 1977615..1978178(-) (comK/comK1) [Staphylococcus gallinarum strain STP534]
ATGAATTTGCATTATGTAATTAAAAAAGGTGATATGGCATTGCAACCTTGTAATGTGTCATTTGGTTTGTTAGAAGGTAC
CCGGGTGTTTAAATATAAGGATGAATGTACAGTAATCAAAGATCGAACACCTAAAATTATTGATCGGTCATGTAGGTTTT
ACGGTAGTAGTTATAATTTTAAAAAAGAGGATACAATGCGAATTACAGGCATTAGTAGTAAACCACCACTTCTATTTACT
CCATTATTTCCCACTTATTTTTTCCCAACTCACTCTGATAGAAAAGACGAAAACACATGGATTAACATTCACTATGTTGA
ACAAATAAAGCCACTAAAGGATAAAAAATGTAAAGTTATCTTTGTAGATGATCAAACGATAACAGTTAATATCTCTGCTC
ACAGTATGCATCATCAATACTTGAATGGTATATATTATTACTACATGATGGATAGAGCAGCTAGAGTAGCTACATTTGAT
CCTGATTCCCCAATTGATTATACAAAACCACAATTAAATATTTATGAAGCATTAGCCAAATACTCTTTATTCGAGCACAA
ATAG

Domains

Predicted by InterproScan.

ComK protein (ComK)

(4-152)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

53.005

97.861

0.519
  comK/comK1 Staphylococcus aureus N315

53.005

97.861

0.519