Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   JKJ03_RS11750 Genome accession   NZ_CP068563
Coordinates   2444286..2444663 (-) Length   125 a.a.
NCBI ID   WP_071391611.1    Uniprot ID   -
Organism   Bacillus velezensis strain GUMT319     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2439286..2449663
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JKJ03_RS11710 (JKJ03_11710) - 2439785..2440579 (+) 795 WP_071391615.1 YqhG family protein -
  JKJ03_RS11715 (JKJ03_11715) sinI 2440756..2440929 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  JKJ03_RS11720 (JKJ03_11720) sinR 2440963..2441298 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  JKJ03_RS11725 (JKJ03_11725) tasA 2441346..2442131 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  JKJ03_RS11730 (JKJ03_11730) sipW 2442195..2442779 (-) 585 WP_060562614.1 signal peptidase I SipW -
  JKJ03_RS11735 (JKJ03_11735) tapA 2442751..2443422 (-) 672 WP_202735627.1 amyloid fiber anchoring/assembly protein TapA -
  JKJ03_RS11740 (JKJ03_11740) - 2443681..2444010 (+) 330 WP_071391612.1 DUF3889 domain-containing protein -
  JKJ03_RS11745 (JKJ03_11745) - 2444050..2444229 (-) 180 WP_003153093.1 YqzE family protein -
  JKJ03_RS11750 (JKJ03_11750) comGG 2444286..2444663 (-) 378 WP_071391611.1 competence type IV pilus minor pilin ComGG Machinery gene
  JKJ03_RS11755 (JKJ03_11755) comGF 2444664..2445059 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  JKJ03_RS11760 (JKJ03_11760) comGE 2445073..2445387 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  JKJ03_RS11765 (JKJ03_11765) comGD 2445371..2445808 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  JKJ03_RS11770 (JKJ03_11770) comGC 2445798..2446106 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  JKJ03_RS11775 (JKJ03_11775) comGB 2446111..2447148 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  JKJ03_RS11780 (JKJ03_11780) comGA 2447135..2448205 (-) 1071 WP_070082113.1 competence type IV pilus ATPase ComGA Machinery gene
  JKJ03_RS11785 (JKJ03_11785) - 2448396..2449346 (-) 951 WP_071391609.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14081.98 Da        Isoelectric Point: 9.3592

>NTDB_id=529469 JKJ03_RS11750 WP_071391611.1 2444286..2444663(-) (comGG) [Bacillus velezensis strain GUMT319]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSSHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=529469 JKJ03_RS11750 WP_071391611.1 2444286..2444663(-) (comGG) [Bacillus velezensis strain GUMT319]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCAGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCACATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAGTGTCAGGCACGAGACGCGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterProScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504