Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | JKJ03_RS11715 | Genome accession | NZ_CP068563 |
| Coordinates | 2440756..2440929 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain GUMT319 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2435756..2445929
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JKJ03_RS11700 (JKJ03_11700) | gcvT | 2436573..2437673 (-) | 1101 | WP_071391617.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| JKJ03_RS11705 (JKJ03_11705) | - | 2438097..2439767 (+) | 1671 | WP_046559872.1 | DEAD/DEAH box helicase | - |
| JKJ03_RS11710 (JKJ03_11710) | - | 2439785..2440579 (+) | 795 | WP_071391615.1 | YqhG family protein | - |
| JKJ03_RS11715 (JKJ03_11715) | sinI | 2440756..2440929 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| JKJ03_RS11720 (JKJ03_11720) | sinR | 2440963..2441298 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| JKJ03_RS11725 (JKJ03_11725) | tasA | 2441346..2442131 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| JKJ03_RS11730 (JKJ03_11730) | sipW | 2442195..2442779 (-) | 585 | WP_060562614.1 | signal peptidase I SipW | - |
| JKJ03_RS11735 (JKJ03_11735) | tapA | 2442751..2443422 (-) | 672 | WP_202735627.1 | amyloid fiber anchoring/assembly protein TapA | - |
| JKJ03_RS11740 (JKJ03_11740) | - | 2443681..2444010 (+) | 330 | WP_071391612.1 | DUF3889 domain-containing protein | - |
| JKJ03_RS11745 (JKJ03_11745) | - | 2444050..2444229 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| JKJ03_RS11750 (JKJ03_11750) | comGG | 2444286..2444663 (-) | 378 | WP_071391611.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| JKJ03_RS11755 (JKJ03_11755) | comGF | 2444664..2445059 (-) | 396 | WP_046559876.1 | competence type IV pilus minor pilin ComGF | - |
| JKJ03_RS11760 (JKJ03_11760) | comGE | 2445073..2445387 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| JKJ03_RS11765 (JKJ03_11765) | comGD | 2445371..2445808 (-) | 438 | WP_025852922.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=529467 JKJ03_RS11715 WP_003153105.1 2440756..2440929(+) (sinI) [Bacillus velezensis strain GUMT319]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=529467 JKJ03_RS11715 WP_003153105.1 2440756..2440929(+) (sinI) [Bacillus velezensis strain GUMT319]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |