Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   JKL50_RS16800 Genome accession   NZ_CP068389
Coordinates   3273065..3273205 (+) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus altitudinis strain ws31     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3268065..3278205
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JKL50_RS16775 (JKL50_16775) - 3268297..3268704 (+) 408 WP_007500468.1 YueI family protein -
  JKL50_RS16780 (JKL50_16780) - 3268765..3269316 (+) 552 WP_008345872.1 cysteine hydrolase family protein -
  JKL50_RS16785 (JKL50_16785) - 3269334..3270803 (+) 1470 WP_007500472.1 nicotinate phosphoribosyltransferase -
  JKL50_RS16790 (JKL50_16790) - 3270943..3272169 (+) 1227 WP_202734717.1 EAL and HDOD domain-containing protein -
  JKL50_RS16795 (JKL50_16795) - 3272206..3272559 (-) 354 WP_019744042.1 hypothetical protein -
  JKL50_RS16800 (JKL50_16800) degQ 3273065..3273205 (+) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  JKL50_RS16805 (JKL50_16805) - 3273357..3274271 (+) 915 WP_202734256.1 polyprenyl synthetase family protein -
  JKL50_RS16810 (JKL50_16810) comX 3274268..3274438 (+) 171 WP_074041927.1 competence pheromone ComX -
  JKL50_RS16815 (JKL50_16815) comP 3274479..3276791 (+) 2313 WP_035701206.1 ATP-binding protein Regulator
  JKL50_RS16820 (JKL50_16820) comA 3276872..3277513 (+) 642 WP_007500477.1 response regulator transcription factor Regulator
  JKL50_RS16825 (JKL50_16825) - 3277537..3277926 (+) 390 WP_008345855.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=528856 JKL50_RS16800 WP_003213123.1 3273065..3273205(+) (degQ) [Bacillus altitudinis strain ws31]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=528856 JKL50_RS16800 WP_003213123.1 3273065..3273205(+) (degQ) [Bacillus altitudinis strain ws31]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696