Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   BAJP3144_RS12590 Genome accession   NZ_CP082283
Coordinates   2589241..2589636 (-) Length   131 a.a.
NCBI ID   WP_025649850.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain JP3144     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2584241..2594636
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAJP3144_RS12545 (BAJP3144_12545) - 2584360..2585154 (+) 795 WP_014418368.1 YqhG family protein -
  BAJP3144_RS12550 (BAJP3144_12550) sinI 2585331..2585504 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  BAJP3144_RS12555 (BAJP3144_12555) sinR 2585538..2585873 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BAJP3144_RS12560 (BAJP3144_12560) tasA 2585921..2586706 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  BAJP3144_RS12565 (BAJP3144_12565) sipW 2586771..2587355 (-) 585 WP_012117977.1 signal peptidase I SipW -
  BAJP3144_RS12570 (BAJP3144_12570) tapA 2587327..2587998 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  BAJP3144_RS12575 (BAJP3144_12575) - 2588257..2588586 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  BAJP3144_RS12580 (BAJP3144_12580) - 2588627..2588806 (-) 180 WP_003153093.1 YqzE family protein -
  BAJP3144_RS12585 (BAJP3144_12585) comGG 2588863..2589240 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  BAJP3144_RS12590 (BAJP3144_12590) comGF 2589241..2589636 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF Machinery gene
  BAJP3144_RS12595 (BAJP3144_12595) comGE 2589650..2589964 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  BAJP3144_RS12600 (BAJP3144_12600) comGD 2589948..2590385 (-) 438 WP_095061019.1 competence type IV pilus minor pilin ComGD Machinery gene
  BAJP3144_RS12605 (BAJP3144_12605) comGC 2590375..2590641 (-) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  BAJP3144_RS12610 (BAJP3144_12610) comGB 2590688..2591725 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  BAJP3144_RS12615 (BAJP3144_12615) comGA 2591712..2592782 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  BAJP3144_RS12620 (BAJP3144_12620) - 2592975..2593925 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 131 a.a.        Molecular weight: 14231.47 Da        Isoelectric Point: 9.6547

>NTDB_id=528048 BAJP3144_RS12590 WP_025649850.1 2589241..2589636(-) (comGF) [Bacillus amyloliquefaciens strain JP3144]
MAVCLFLSGTLGPILHLFLSNRTDNGGLDSREHQIAVQQIMNECKQAETVKPADGGRALACRKTGGEEVRFEIYHKMIRK
RVNGKGHVPILQNAASLTADVKNGLLLLEISSVTGKKNQAVIPVYSSFKGD

Nucleotide


Download         Length: 396 bp        

>NTDB_id=528048 BAJP3144_RS12590 WP_025649850.1 2589241..2589636(-) (comGF) [Bacillus amyloliquefaciens strain JP3144]
TTGGCAGTCTGTCTTTTCCTATCAGGCACCCTGGGCCCGATTTTACATCTGTTCTTATCAAACCGGACCGATAACGGCGG
ATTAGACAGCCGGGAGCATCAAATTGCCGTTCAGCAGATCATGAACGAATGTAAACAGGCTGAGACTGTGAAGCCGGCGG
ACGGCGGACGGGCGTTAGCATGCCGGAAAACAGGAGGCGAAGAAGTGCGTTTTGAAATTTATCATAAGATGATAAGGAAA
AGAGTAAACGGAAAAGGCCACGTGCCGATCCTGCAAAACGCGGCATCATTAACGGCTGATGTGAAAAATGGCCTGCTCTT
ATTAGAGATCTCAAGCGTTACAGGTAAAAAGAATCAGGCGGTCATTCCGGTTTACAGCTCTTTTAAAGGTGATTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

46.825

96.183

0.45