Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   K7B13_RS11895 Genome accession   NZ_CP082278
Coordinates   2360692..2360958 (-) Length   88 a.a.
NCBI ID   WP_258415241.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain 35M     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2355692..2365958
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K7B13_RS11850 (K7B13_11850) sinI 2356373..2356546 (+) 174 WP_013352860.1 anti-repressor SinI Regulator
  K7B13_RS11855 (K7B13_11855) sinR 2356580..2356915 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  K7B13_RS11860 (K7B13_11860) tasA 2356963..2357748 (-) 786 WP_013352862.1 biofilm matrix protein TasA -
  K7B13_RS11865 (K7B13_11865) sipW 2357813..2358397 (-) 585 WP_212098460.1 signal peptidase I SipW -
  K7B13_RS11870 (K7B13_11870) tapA 2358369..2359040 (-) 672 WP_212098462.1 amyloid fiber anchoring/assembly protein TapA -
  K7B13_RS11875 (K7B13_11875) - 2359298..2359627 (+) 330 WP_045510605.1 DUF3889 domain-containing protein -
  K7B13_RS11880 (K7B13_11880) - 2359668..2359847 (-) 180 WP_016938971.1 YqzE family protein -
  K7B13_RS11885 (K7B13_11885) comGG 2359904..2360281 (-) 378 WP_212098464.1 competence type IV pilus minor pilin ComGG Machinery gene
  K7B13_RS11890 (K7B13_11890) comGF 2360283..2360678 (-) 396 WP_212101733.1 competence type IV pilus minor pilin ComGF Machinery gene
  K7B13_RS11895 (K7B13_11895) comGE 2360692..2360958 (-) 267 WP_258415241.1 type II secretion system protein Machinery gene
  K7B13_RS11900 (K7B13_11900) comGD 2360990..2361427 (-) 438 WP_045510590.1 competence type IV pilus minor pilin ComGD Machinery gene
  K7B13_RS11905 (K7B13_11905) comGC 2361417..2361725 (-) 309 WP_115997634.1 competence type IV pilus major pilin ComGC Machinery gene
  K7B13_RS11910 (K7B13_11910) comGB 2361730..2362767 (-) 1038 WP_212098466.1 competence type IV pilus assembly protein ComGB Machinery gene
  K7B13_RS11915 (K7B13_11915) comGA 2362754..2363824 (-) 1071 WP_115997636.1 competence type IV pilus ATPase ComGA Machinery gene
  K7B13_RS11920 (K7B13_11920) - 2364017..2364967 (-) 951 WP_212098468.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 10202.00 Da        Isoelectric Point: 7.1302

>NTDB_id=527749 K7B13_RS11895 WP_258415241.1 2360692..2360958(-) (comGE) [Bacillus amyloliquefaciens strain 35M]
MAIWLFLMISIVPVWTGMLTDNLKIEERQEAYQLLHKHISAYMMSGKKQPSPGVTWKEDGDYYKVCAAVRGEKEMCLSIL
KTEWLYAS

Nucleotide


Download         Length: 267 bp        

>NTDB_id=527749 K7B13_RS11895 WP_258415241.1 2360692..2360958(-) (comGE) [Bacillus amyloliquefaciens strain 35M]
ATGGCTATTTGGCTGTTCCTTATGATTTCTATCGTTCCGGTCTGGACGGGCATGCTGACAGACAATCTGAAAATAGAAGA
ACGCCAGGAAGCGTACCAGCTTCTTCATAAACATATCAGCGCATATATGATGTCCGGAAAAAAGCAGCCGTCTCCCGGTG
TGACGTGGAAGGAGGATGGTGATTATTACAAAGTCTGTGCGGCTGTCCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTC
AAAACAGAATGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

40.404

100

0.455