Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   I6I91_RS02695 Genome accession   NZ_CP068104
Coordinates   524375..524848 (-) Length   157 a.a.
NCBI ID   WP_201626929.1    Uniprot ID   -
Organism   Pediococcus pentosaceus strain FDAARGOS_1134     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 492949..536562 524375..524848 within 0


Gene organization within MGE regions


Location: 492949..536562
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I6I91_RS02505 (I6I91_02505) - 492949..493593 (+) 645 WP_201626884.1 lysophospholipid acyltransferase family protein -
  I6I91_RS02510 (I6I91_02510) - 493605..493826 (-) 222 WP_002833599.1 YneF family protein -
  I6I91_RS02515 (I6I91_02515) - 493897..494145 (-) 249 WP_002833598.1 DUF896 domain-containing protein -
  I6I91_RS02520 (I6I91_02520) lexA 494279..494908 (+) 630 WP_002833597.1 transcriptional repressor LexA -
  I6I91_RS02525 (I6I91_02525) - 494987..495586 (+) 600 WP_011673312.1 hypothetical protein -
  I6I91_RS02530 (I6I91_02530) - 495626..496792 (-) 1167 WP_023440307.1 hydroxymethylglutaryl-CoA synthase -
  I6I91_RS02535 (I6I91_02535) - 496953..498329 (-) 1377 WP_201626886.1 amino acid permease -
  I6I91_RS02540 (I6I91_02540) - 499457..500575 (-) 1119 WP_236593420.1 N-acetylmuramoyl-L-alanine amidase -
  I6I91_RS02545 (I6I91_02545) - 500559..501095 (-) 537 WP_201626895.1 phage holin family protein -
  I6I91_RS02550 (I6I91_02550) - 501129..501380 (-) 252 WP_201626897.1 hypothetical protein -
  I6I91_RS02555 (I6I91_02555) - 501382..501807 (-) 426 WP_201626899.1 hypothetical protein -
  I6I91_RS02560 (I6I91_02560) - 501797..502036 (-) 240 WP_195751034.1 hypothetical protein -
  I6I91_RS02565 (I6I91_02565) - 502033..506157 (-) 4125 WP_201626900.1 phage tail protein -
  I6I91_RS02570 (I6I91_02570) - 506176..507006 (-) 831 WP_201626901.1 phage tail domain-containing protein -
  I6I91_RS02575 (I6I91_02575) - 507021..510842 (-) 3822 WP_201626902.1 phage tail tape measure protein -
  I6I91_RS02580 (I6I91_02580) - 510842..511060 (-) 219 WP_195751031.1 hypothetical protein -
  I6I91_RS02585 (I6I91_02585) - 511150..511599 (-) 450 WP_195751030.1 tail assembly chaperone -
  I6I91_RS02590 (I6I91_02590) - 511678..511968 (-) 291 WP_201626903.1 Ig-like domain-containing protein -
  I6I91_RS02595 (I6I91_02595) - 511928..512524 (-) 597 WP_195751028.1 phage major tail protein, TP901-1 family -
  I6I91_RS02600 (I6I91_02600) - 512542..512844 (-) 303 WP_236593421.1 hypothetical protein -
  I6I91_RS02605 (I6I91_02605) - 512903..513259 (-) 357 WP_201626904.1 HK97-gp10 family putative phage morphogenesis protein -
  I6I91_RS02610 (I6I91_02610) - 513256..513546 (-) 291 WP_201626905.1 hypothetical protein -
  I6I91_RS02615 (I6I91_02615) - 513546..513884 (-) 339 WP_201626907.1 phage head-tail connector protein -
  I6I91_RS02620 (I6I91_02620) - 513898..514131 (-) 234 WP_236593422.1 Ig-like domain-containing protein -
  I6I91_RS02625 (I6I91_02625) - 514182..515039 (-) 858 WP_201626909.1 capsid protein -
  I6I91_RS02630 (I6I91_02630) - 515052..515627 (-) 576 WP_201626911.1 DUF4355 domain-containing protein -
  I6I91_RS08755 - 515730..515888 (-) 159 WP_195751021.1 hypothetical protein -
  I6I91_RS02635 (I6I91_02635) - 515944..516888 (-) 945 WP_201626913.1 minor capsid protein -
  I6I91_RS02640 (I6I91_02640) - 516872..518467 (-) 1596 WP_236593423.1 phage portal protein -
  I6I91_RS02645 (I6I91_02645) - 518473..519744 (-) 1272 WP_201627087.1 PBSX family phage terminase large subunit -
  I6I91_RS02650 (I6I91_02650) - 519737..520078 (-) 342 WP_195751017.1 phBC6A51 family helix-turn-helix protein -
  I6I91_RS08760 - 520151..520333 (-) 183 WP_236593425.1 hypothetical protein -
  I6I91_RS02655 (I6I91_02655) - 520345..520743 (-) 399 WP_195751015.1 hypothetical protein -
  I6I91_RS02660 (I6I91_02660) - 520940..521875 (-) 936 WP_195751014.1 hypothetical protein -
  I6I91_RS02665 (I6I91_02665) - 521917..522375 (-) 459 WP_201626917.1 hypothetical protein -
  I6I91_RS02670 (I6I91_02670) - 522453..522743 (-) 291 WP_201626919.1 hypothetical protein -
  I6I91_RS02675 (I6I91_02675) - 522816..523190 (-) 375 WP_201626921.1 MazG-like family protein -
  I6I91_RS02680 (I6I91_02680) - 523407..523610 (-) 204 WP_201626923.1 hypothetical protein -
  I6I91_RS02685 (I6I91_02685) - 523603..523908 (-) 306 WP_201626925.1 hypothetical protein -
  I6I91_RS02690 (I6I91_02690) - 523905..524363 (-) 459 WP_201626927.1 hypothetical protein -
  I6I91_RS02695 (I6I91_02695) ssb 524375..524848 (-) 474 WP_201626929.1 single-stranded DNA-binding protein Machinery gene
  I6I91_RS02700 (I6I91_02700) - 525013..525708 (-) 696 WP_201626931.1 putative HNHc nuclease -
  I6I91_RS02705 (I6I91_02705) - 525712..526542 (-) 831 WP_201626933.1 helix-turn-helix domain-containing protein -
  I6I91_RS02710 (I6I91_02710) - 526553..527398 (-) 846 WP_236593427.1 PD-(D/E)XK nuclease-like domain-containing protein -
  I6I91_RS02715 (I6I91_02715) bet 527358..528125 (-) 768 WP_236593429.1 phage recombination protein Bet -
  I6I91_RS08870 - 528318..528449 (-) 132 WP_256677761.1 hypothetical protein -
  I6I91_RS02720 (I6I91_02720) - 528463..528738 (-) 276 WP_159251096.1 helix-turn-helix domain-containing protein -
  I6I91_RS02725 (I6I91_02725) - 528739..529197 (-) 459 WP_236593431.1 helix-turn-helix transcriptional regulator -
  I6I91_RS02730 (I6I91_02730) - 529271..529441 (-) 171 WP_195748902.1 hypothetical protein -
  I6I91_RS08765 - 529475..529693 (-) 219 WP_229564764.1 helix-turn-helix domain-containing protein -
  I6I91_RS02740 (I6I91_02740) - 529864..530238 (+) 375 WP_230491138.1 helix-turn-helix domain-containing protein -
  I6I91_RS02745 (I6I91_02745) - 530250..530657 (+) 408 WP_195753212.1 ImmA/IrrE family metallo-endopeptidase -
  I6I91_RS08895 (I6I91_02755) - 530716..531900 (+) 1185 WP_330857698.1 DUF5067 domain-containing protein -
  I6I91_RS02760 (I6I91_02760) - 531988..532617 (+) 630 WP_201626935.1 hypothetical protein -
  I6I91_RS02765 (I6I91_02765) - 532645..533820 (+) 1176 WP_201626937.1 MrcB family domain-containing protein -
  I6I91_RS02770 (I6I91_02770) - 533899..534390 (+) 492 WP_201626939.1 hypothetical protein -
  I6I91_RS02775 (I6I91_02775) - 534493..535665 (+) 1173 WP_201626941.1 tyrosine-type recombinase/integrase -
  I6I91_RS02780 (I6I91_02780) fabI 535804..536562 (-) 759 WP_041525505.1 enoyl-ACP reductase FabI -

Sequence


Protein


Download         Length: 157 a.a.        Molecular weight: 17862.59 Da        Isoelectric Point: 4.7512

>NTDB_id=527098 I6I91_RS02695 WP_201626929.1 524375..524848(-) (ssb) [Pediococcus pentosaceus strain FDAARGOS_1134]
MINRIVLVGRLTNDPELKYTGNDVAVAIFTVAVNRQFTNSQGESEADFIRCQMWRKAAENFCNFTRKGSLVGIDGRIQTR
SYENQQGTRVYVTEVVAENFSLLESKNSSQNEQFEQNKPQNNGQNYQNQQNGQSSPSRNPNDPFNSMPDIKDDDLPF

Nucleotide


Download         Length: 474 bp        

>NTDB_id=527098 I6I91_RS02695 WP_201626929.1 524375..524848(-) (ssb) [Pediococcus pentosaceus strain FDAARGOS_1134]
ATGATTAATCGAATAGTATTAGTCGGGCGGTTAACCAACGATCCAGAACTAAAATACACAGGCAATGATGTAGCAGTTGC
AATCTTCACAGTAGCCGTTAATCGGCAATTTACTAATTCGCAAGGCGAAAGTGAAGCAGATTTTATTAGATGCCAAATGT
GGCGCAAAGCTGCTGAAAACTTCTGTAACTTCACCCGAAAAGGTTCGCTAGTTGGTATTGATGGACGAATTCAAACTCGC
TCATACGAAAATCAACAAGGAACACGAGTTTACGTTACTGAGGTCGTAGCTGAGAACTTCTCGCTACTTGAGTCCAAAAA
CAGTAGCCAAAATGAACAATTTGAACAGAATAAACCTCAAAATAACGGACAAAATTACCAGAATCAACAAAATGGTCAAT
CATCACCTAGCAGAAATCCTAACGACCCATTTAATAGCATGCCGGATATCAAGGATGATGATTTACCGTTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

56.322

100

0.624

  ssbA Bacillus subtilis subsp. subtilis str. 168

52

100

0.58

  ssbB Bacillus subtilis subsp. subtilis str. 168

56.604

67.516

0.382