Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   JEQ25_RS13160 Genome accession   NZ_CP066380
Coordinates   2507218..2507601 (-) Length   127 a.a.
NCBI ID   WP_046160582.1    Uniprot ID   A0AA96UKP5
Organism   Bacillus subtilis strain ID-A05     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2502218..2512601
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JEQ25_RS13120 (JEQ25_13040) sinI 2503151..2503324 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  JEQ25_RS13125 (JEQ25_13045) sinR 2503358..2503693 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  JEQ25_RS13130 (JEQ25_13050) tasA 2503786..2504571 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  JEQ25_RS13135 (JEQ25_13055) sipW 2504635..2505207 (-) 573 WP_003230181.1 signal peptidase I -
  JEQ25_RS13140 (JEQ25_13060) tapA 2505191..2505952 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  JEQ25_RS13145 (JEQ25_13065) yqzG 2506224..2506550 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  JEQ25_RS13150 (JEQ25_13070) spoIIT 2506592..2506771 (-) 180 WP_029726723.1 YqzE family protein -
  JEQ25_RS13155 (JEQ25_13075) comGG 2506843..2507217 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  JEQ25_RS13160 (JEQ25_13080) comGF 2507218..2507601 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  JEQ25_RS13165 (JEQ25_13085) comGE 2507627..2507974 (-) 348 WP_046381178.1 ComG operon protein 5 Machinery gene
  JEQ25_RS13170 (JEQ25_13090) comGD 2507958..2508389 (-) 432 WP_046381179.1 comG operon protein ComGD Machinery gene
  JEQ25_RS13175 (JEQ25_13095) comGC 2508379..2508675 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  JEQ25_RS13180 (JEQ25_13100) comGB 2508689..2509726 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  JEQ25_RS13185 (JEQ25_13105) comGA 2509713..2510783 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  JEQ25_RS13190 (JEQ25_13110) - 2510995..2511192 (-) 198 WP_014480259.1 CBS domain-containing protein -
  JEQ25_RS13195 (JEQ25_13115) corA 2511194..2512147 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14306.38 Da        Isoelectric Point: 5.5289

>NTDB_id=519828 JEQ25_RS13160 WP_046160582.1 2507218..2507601(-) (comGF) [Bacillus subtilis strain ID-A05]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYQSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=519828 JEQ25_RS13160 WP_046160582.1 2507218..2507601(-) (comGF) [Bacillus subtilis strain ID-A05]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCAATCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984