Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   JEQ25_RS13120 Genome accession   NZ_CP066380
Coordinates   2503151..2503324 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain ID-A05     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2498151..2508324
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JEQ25_RS13105 (JEQ25_13025) gcvT 2498950..2500038 (-) 1089 WP_003230205.1 glycine cleavage system aminomethyltransferase GcvT -
  JEQ25_RS13110 (JEQ25_13030) yqhH 2500480..2502153 (+) 1674 WP_003230203.1 SNF2-related protein -
  JEQ25_RS13115 (JEQ25_13035) yqhG 2502174..2502968 (+) 795 WP_003230200.1 YqhG family protein -
  JEQ25_RS13120 (JEQ25_13040) sinI 2503151..2503324 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  JEQ25_RS13125 (JEQ25_13045) sinR 2503358..2503693 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  JEQ25_RS13130 (JEQ25_13050) tasA 2503786..2504571 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  JEQ25_RS13135 (JEQ25_13055) sipW 2504635..2505207 (-) 573 WP_003230181.1 signal peptidase I -
  JEQ25_RS13140 (JEQ25_13060) tapA 2505191..2505952 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  JEQ25_RS13145 (JEQ25_13065) yqzG 2506224..2506550 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  JEQ25_RS13150 (JEQ25_13070) spoIIT 2506592..2506771 (-) 180 WP_029726723.1 YqzE family protein -
  JEQ25_RS13155 (JEQ25_13075) comGG 2506843..2507217 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  JEQ25_RS13160 (JEQ25_13080) comGF 2507218..2507601 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  JEQ25_RS13165 (JEQ25_13085) comGE 2507627..2507974 (-) 348 WP_046381178.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=519825 JEQ25_RS13120 WP_003230187.1 2503151..2503324(+) (sinI) [Bacillus subtilis strain ID-A05]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=519825 JEQ25_RS13120 WP_003230187.1 2503151..2503324(+) (sinI) [Bacillus subtilis strain ID-A05]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1