Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   JEQ24_RS13550 Genome accession   NZ_CP066379
Coordinates   2704486..2704863 (-) Length   125 a.a.
NCBI ID   WP_022552965.1    Uniprot ID   -
Organism   Bacillus velezensis strain ID-A04     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2699486..2709863
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JEQ24_RS13510 (JEQ24_13360) - 2699983..2700777 (+) 795 WP_014418368.1 YqhG family protein -
  JEQ24_RS13515 (JEQ24_13365) sinI 2700954..2701127 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  JEQ24_RS13520 (JEQ24_13370) sinR 2701161..2701496 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  JEQ24_RS13525 (JEQ24_13375) - 2701544..2702329 (-) 786 WP_007408329.1 TasA family protein -
  JEQ24_RS13530 (JEQ24_13380) - 2702394..2702978 (-) 585 WP_022552967.1 signal peptidase I -
  JEQ24_RS13535 (JEQ24_13385) tapA 2702950..2703621 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  JEQ24_RS13540 (JEQ24_13390) - 2703880..2704209 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  JEQ24_RS13545 (JEQ24_13395) - 2704250..2704429 (-) 180 WP_022552966.1 YqzE family protein -
  JEQ24_RS13550 (JEQ24_13400) comGG 2704486..2704863 (-) 378 WP_022552965.1 competence type IV pilus minor pilin ComGG Machinery gene
  JEQ24_RS13555 (JEQ24_13405) comGF 2704864..2705259 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  JEQ24_RS13560 (JEQ24_13410) comGE 2705273..2705587 (-) 315 WP_021494312.1 competence type IV pilus minor pilin ComGE Machinery gene
  JEQ24_RS13565 (JEQ24_13415) comGD 2705571..2706008 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  JEQ24_RS13570 (JEQ24_13420) comGC 2705998..2706306 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  JEQ24_RS13575 (JEQ24_13425) comGB 2706311..2707348 (-) 1038 WP_022552962.1 competence type IV pilus assembly protein ComGB Machinery gene
  JEQ24_RS13580 (JEQ24_13430) comGA 2707335..2708405 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  JEQ24_RS13585 (JEQ24_13435) - 2708598..2709548 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14207.16 Da        Isoelectric Point: 9.9338

>NTDB_id=519747 JEQ24_RS13550 WP_022552965.1 2704486..2704863(-) (comGG) [Bacillus velezensis strain ID-A04]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHINGSDRRETVQVTIQAETKTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=519747 JEQ24_RS13550 WP_022552965.1 2704486..2704863(-) (comGG) [Bacillus velezensis strain ID-A04]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTCACATCAACGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCAAGACAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504