Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   JEQ24_RS13515 Genome accession   NZ_CP066379
Coordinates   2700954..2701127 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain ID-A04     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2695954..2706127
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JEQ24_RS13500 (JEQ24_13350) gcvT 2696767..2697867 (-) 1101 WP_017418134.1 glycine cleavage system aminomethyltransferase GcvT -
  JEQ24_RS13505 (JEQ24_13355) - 2698291..2699961 (+) 1671 WP_038461530.1 SNF2-related protein -
  JEQ24_RS13510 (JEQ24_13360) - 2699983..2700777 (+) 795 WP_014418368.1 YqhG family protein -
  JEQ24_RS13515 (JEQ24_13365) sinI 2700954..2701127 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  JEQ24_RS13520 (JEQ24_13370) sinR 2701161..2701496 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  JEQ24_RS13525 (JEQ24_13375) - 2701544..2702329 (-) 786 WP_007408329.1 TasA family protein -
  JEQ24_RS13530 (JEQ24_13380) - 2702394..2702978 (-) 585 WP_022552967.1 signal peptidase I -
  JEQ24_RS13535 (JEQ24_13385) tapA 2702950..2703621 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  JEQ24_RS13540 (JEQ24_13390) - 2703880..2704209 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  JEQ24_RS13545 (JEQ24_13395) - 2704250..2704429 (-) 180 WP_022552966.1 YqzE family protein -
  JEQ24_RS13550 (JEQ24_13400) comGG 2704486..2704863 (-) 378 WP_022552965.1 competence type IV pilus minor pilin ComGG Machinery gene
  JEQ24_RS13555 (JEQ24_13405) comGF 2704864..2705259 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  JEQ24_RS13560 (JEQ24_13410) comGE 2705273..2705587 (-) 315 WP_021494312.1 competence type IV pilus minor pilin ComGE Machinery gene
  JEQ24_RS13565 (JEQ24_13415) comGD 2705571..2706008 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=519745 JEQ24_RS13515 WP_014418369.1 2700954..2701127(+) (sinI) [Bacillus velezensis strain ID-A04]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=519745 JEQ24_RS13515 WP_014418369.1 2700954..2701127(+) (sinI) [Bacillus velezensis strain ID-A04]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719