Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   JEQ16_RS11860 Genome accession   NZ_CP066377
Coordinates   2450359..2450796 (-) Length   145 a.a.
NCBI ID   WP_278071168.1    Uniprot ID   -
Organism   Bacillus velezensis strain ID-A01     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2445359..2455796
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JEQ16_RS11810 (JEQ16_11750) sinI 2445744..2445917 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  JEQ16_RS11815 (JEQ16_11755) sinR 2445951..2446286 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  JEQ16_RS11820 (JEQ16_11760) - 2446334..2447119 (-) 786 WP_156735549.1 TasA family protein -
  JEQ16_RS11825 (JEQ16_11765) - 2447183..2447767 (-) 585 WP_060562614.1 signal peptidase I -
  JEQ16_RS11830 (JEQ16_11770) tapA 2447739..2448410 (-) 672 WP_278071167.1 amyloid fiber anchoring/assembly protein TapA -
  JEQ16_RS11835 (JEQ16_11775) - 2448669..2448998 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  JEQ16_RS11840 (JEQ16_11780) - 2449038..2449217 (-) 180 WP_003153093.1 YqzE family protein -
  JEQ16_RS11845 (JEQ16_11785) comGG 2449274..2449651 (-) 378 WP_063174754.1 competence type IV pilus minor pilin ComGG Machinery gene
  JEQ16_RS11850 (JEQ16_11790) comGF 2449652..2450047 (-) 396 WP_094247733.1 competence type IV pilus minor pilin ComGF -
  JEQ16_RS11855 (JEQ16_11795) comGE 2450061..2450375 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  JEQ16_RS11860 (JEQ16_11800) comGD 2450359..2450796 (-) 438 WP_278071168.1 competence type IV pilus minor pilin ComGD Machinery gene
  JEQ16_RS11865 (JEQ16_11805) comGC 2450786..2451094 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  JEQ16_RS11870 (JEQ16_11810) comGB 2451099..2452136 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  JEQ16_RS11875 (JEQ16_11815) comGA 2452123..2453193 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  JEQ16_RS11880 (JEQ16_11820) - 2453385..2454335 (-) 951 WP_071391609.1 magnesium transporter CorA family protein -
  JEQ16_RS11885 (JEQ16_11825) - 2454481..2455782 (+) 1302 WP_070082114.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16296.84 Da        Isoelectric Point: 10.3354

>NTDB_id=519597 JEQ16_RS11860 WP_278071168.1 2450359..2450796(-) (comGD) [Bacillus velezensis strain ID-A01]
MNNNRRTENGFTLLESLIVLSLASVLLTILFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIRLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=519597 JEQ16_RS11860 WP_278071168.1 2450359..2450796(-) (comGD) [Bacillus velezensis strain ID-A01]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGATTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTACCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAACGTTCTTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAATGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCGATTGAAGAGCGCTGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.164

100

0.566