Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   JEQ16_RS11810 Genome accession   NZ_CP066377
Coordinates   2445744..2445917 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain ID-A01     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2440744..2450917
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JEQ16_RS11795 (JEQ16_11735) gcvT 2441561..2442661 (-) 1101 WP_058906182.1 glycine cleavage system aminomethyltransferase GcvT -
  JEQ16_RS11800 (JEQ16_11740) - 2443085..2444755 (+) 1671 WP_128574830.1 SNF2-related protein -
  JEQ16_RS11805 (JEQ16_11745) - 2444773..2445567 (+) 795 WP_014305407.1 YqhG family protein -
  JEQ16_RS11810 (JEQ16_11750) sinI 2445744..2445917 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  JEQ16_RS11815 (JEQ16_11755) sinR 2445951..2446286 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  JEQ16_RS11820 (JEQ16_11760) - 2446334..2447119 (-) 786 WP_156735549.1 TasA family protein -
  JEQ16_RS11825 (JEQ16_11765) - 2447183..2447767 (-) 585 WP_060562614.1 signal peptidase I -
  JEQ16_RS11830 (JEQ16_11770) tapA 2447739..2448410 (-) 672 WP_278071167.1 amyloid fiber anchoring/assembly protein TapA -
  JEQ16_RS11835 (JEQ16_11775) - 2448669..2448998 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  JEQ16_RS11840 (JEQ16_11780) - 2449038..2449217 (-) 180 WP_003153093.1 YqzE family protein -
  JEQ16_RS11845 (JEQ16_11785) comGG 2449274..2449651 (-) 378 WP_063174754.1 competence type IV pilus minor pilin ComGG Machinery gene
  JEQ16_RS11850 (JEQ16_11790) comGF 2449652..2450047 (-) 396 WP_094247733.1 competence type IV pilus minor pilin ComGF -
  JEQ16_RS11855 (JEQ16_11795) comGE 2450061..2450375 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  JEQ16_RS11860 (JEQ16_11800) comGD 2450359..2450796 (-) 438 WP_278071168.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=519593 JEQ16_RS11810 WP_003153105.1 2445744..2445917(+) (sinI) [Bacillus velezensis strain ID-A01]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=519593 JEQ16_RS11810 WP_003153105.1 2445744..2445917(+) (sinI) [Bacillus velezensis strain ID-A01]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCTCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702