Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   JFU10_RS06065 Genome accession   NZ_CP066337
Coordinates   1296636..1296776 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain Mr12     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1291636..1301776
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JFU10_RS06040 - 1291976..1292359 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  JFU10_RS06045 comA 1292381..1293025 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  JFU10_RS06050 comP 1293106..1295397 (-) 2292 WP_039254056.1 histidine kinase Regulator
  JFU10_RS06055 comX 1295409..1295573 (-) 165 WP_007613432.1 competence pheromone ComX -
  JFU10_RS06060 - 1295573..1296484 (-) 912 WP_031378407.1 polyprenyl synthetase family protein -
  JFU10_RS06065 degQ 1296636..1296776 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  JFU10_RS06070 - 1297242..1297583 (+) 342 WP_014305721.1 hypothetical protein -
  JFU10_RS06075 - 1297590..1298810 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  JFU10_RS06080 - 1298939..1300405 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  JFU10_RS06085 - 1300423..1300974 (-) 552 WP_025853916.1 cysteine hydrolase family protein -
  JFU10_RS06090 - 1301071..1301469 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=519315 JFU10_RS06065 WP_003152043.1 1296636..1296776(-) (degQ) [Bacillus velezensis strain Mr12]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=519315 JFU10_RS06065 WP_003152043.1 1296636..1296776(-) (degQ) [Bacillus velezensis strain Mr12]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891