Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   JD965_RS12225 Genome accession   NZ_CP066219
Coordinates   2421873..2422187 (-) Length   104 a.a.
NCBI ID   WP_045926718.1    Uniprot ID   -
Organism   Bacillus siamensis strain B28     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2416873..2427187
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JD965_RS12180 (JD965_12180) sinI 2417529..2417702 (+) 174 WP_016938977.1 anti-repressor SinI Regulator
  JD965_RS12185 (JD965_12185) sinR 2417736..2418071 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  JD965_RS12190 (JD965_12190) tasA 2418146..2418931 (-) 786 WP_047475632.1 biofilm matrix protein TasA -
  JD965_RS12195 (JD965_12195) sipW 2418995..2419579 (-) 585 WP_016938975.1 signal peptidase I SipW -
  JD965_RS12200 (JD965_12200) tapA 2419551..2420222 (-) 672 WP_198697876.1 amyloid fiber anchoring/assembly protein TapA -
  JD965_RS12205 (JD965_12205) - 2420481..2420810 (+) 330 WP_198697877.1 DUF3889 domain-containing protein -
  JD965_RS12210 (JD965_12210) - 2420850..2421029 (-) 180 WP_016938971.1 YqzE family protein -
  JD965_RS12215 (JD965_12215) comGG 2421086..2421463 (-) 378 WP_188154558.1 competence type IV pilus minor pilin ComGG Machinery gene
  JD965_RS12220 (JD965_12220) comGF 2421464..2421961 (-) 498 WP_232904794.1 competence type IV pilus minor pilin ComGF -
  JD965_RS12225 (JD965_12225) comGE 2421873..2422187 (-) 315 WP_045926718.1 competence type IV pilus minor pilin ComGE Machinery gene
  JD965_RS12230 (JD965_12230) comGD 2422171..2422608 (-) 438 WP_045926719.1 competence type IV pilus minor pilin ComGD Machinery gene
  JD965_RS12235 (JD965_12235) comGC 2422598..2422906 (-) 309 WP_016938966.1 competence type IV pilus major pilin ComGC Machinery gene
  JD965_RS12240 (JD965_12240) comGB 2422911..2423948 (-) 1038 WP_198697878.1 competence type IV pilus assembly protein ComGB Machinery gene
  JD965_RS12245 (JD965_12245) comGA 2423935..2425005 (-) 1071 WP_045926720.1 competence type IV pilus ATPase ComGA Machinery gene
  JD965_RS12250 (JD965_12250) - 2425198..2426148 (-) 951 WP_198697879.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11930.90 Da        Isoelectric Point: 7.7788

>NTDB_id=518511 JD965_RS12225 WP_045926718.1 2421873..2422187(-) (comGE) [Bacillus siamensis strain B28]
MQNGNKGFSTIETLSAMAIWLFLMISIVPVWTDMLTDNLKTEERQKARQLLQERISAYMMSGKKQPSPGVTWKEEGDYYK
VCAAVRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=518511 JD965_RS12225 WP_045926718.1 2421873..2422187(-) (comGE) [Bacillus siamensis strain B28]
ATGCAGAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTTCTTATGATTTCTAT
CGTTCCGGTCTGGACGGACATGCTGACGGATAATCTGAAAACAGAGGAACGTCAAAAAGCGCGCCAGCTTCTTCAGGAAC
GTATCAGCGCTTATATGATGTCCGGAAAAAAGCAGCCGTCTCCCGGTGTGACGTGGAAGGAGGAAGGTGATTATTACAAA
GTCTGTGCGGCTGTCCGCGGCGAAAAAGAAATGTGTCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

45.946

100

0.49