Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   JD965_RS12180 Genome accession   NZ_CP066219
Coordinates   2417529..2417702 (+) Length   57 a.a.
NCBI ID   WP_016938977.1    Uniprot ID   -
Organism   Bacillus siamensis strain B28     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2412529..2422702
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JD965_RS12165 (JD965_12165) gcvT 2413341..2414441 (-) 1101 WP_198697875.1 glycine cleavage system aminomethyltransferase GcvT -
  JD965_RS12170 (JD965_12170) - 2414866..2416536 (+) 1671 WP_045926712.1 DEAD/DEAH box helicase -
  JD965_RS12175 (JD965_12175) - 2416558..2417352 (+) 795 WP_099744652.1 YqhG family protein -
  JD965_RS12180 (JD965_12180) sinI 2417529..2417702 (+) 174 WP_016938977.1 anti-repressor SinI Regulator
  JD965_RS12185 (JD965_12185) sinR 2417736..2418071 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  JD965_RS12190 (JD965_12190) tasA 2418146..2418931 (-) 786 WP_047475632.1 biofilm matrix protein TasA -
  JD965_RS12195 (JD965_12195) sipW 2418995..2419579 (-) 585 WP_016938975.1 signal peptidase I SipW -
  JD965_RS12200 (JD965_12200) tapA 2419551..2420222 (-) 672 WP_198697876.1 amyloid fiber anchoring/assembly protein TapA -
  JD965_RS12205 (JD965_12205) - 2420481..2420810 (+) 330 WP_198697877.1 DUF3889 domain-containing protein -
  JD965_RS12210 (JD965_12210) - 2420850..2421029 (-) 180 WP_016938971.1 YqzE family protein -
  JD965_RS12215 (JD965_12215) comGG 2421086..2421463 (-) 378 WP_188154558.1 competence type IV pilus minor pilin ComGG Machinery gene
  JD965_RS12220 (JD965_12220) comGF 2421464..2421961 (-) 498 WP_232904794.1 competence type IV pilus minor pilin ComGF -
  JD965_RS12225 (JD965_12225) comGE 2421873..2422187 (-) 315 WP_045926718.1 competence type IV pilus minor pilin ComGE Machinery gene
  JD965_RS12230 (JD965_12230) comGD 2422171..2422608 (-) 438 WP_045926719.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6719.70 Da        Isoelectric Point: 9.8173

>NTDB_id=518508 JD965_RS12180 WP_016938977.1 2417529..2417702(+) (sinI) [Bacillus siamensis strain B28]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=518508 JD965_RS12180 WP_016938977.1 2417529..2417702(+) (sinI) [Bacillus siamensis strain B28]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCTCAAAAAGCAAATAT
CAGCCTGGAAGAAATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

68.421

100

0.684