Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   JD965_RS01930 Genome accession   NZ_CP066219
Coordinates   382599..382718 (+) Length   39 a.a.
NCBI ID   WP_016937261.1    Uniprot ID   -
Organism   Bacillus siamensis strain B28     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 377599..387718
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JD965_RS01915 (JD965_01915) - 379210..379893 (+) 684 WP_016937264.1 response regulator transcription factor -
  JD965_RS01920 (JD965_01920) - 379880..381313 (+) 1434 WP_198698363.1 sensor histidine kinase -
  JD965_RS01925 (JD965_01925) rapC 381467..382615 (+) 1149 WP_045926250.1 tetratricopeptide repeat protein Regulator
  JD965_RS01930 (JD965_01930) phrC 382599..382718 (+) 120 WP_016937261.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  JD965_RS01935 (JD965_01935) - 382860..382958 (-) 99 WP_016937260.1 YjcZ family sporulation protein -
  JD965_RS01940 (JD965_01940) - 383055..384419 (-) 1365 WP_198698364.1 aspartate kinase -
  JD965_RS01945 (JD965_01945) ceuB 384834..385787 (+) 954 WP_045926248.1 ABC transporter permease Machinery gene
  JD965_RS01950 (JD965_01950) - 385777..386724 (+) 948 WP_198698365.1 iron chelate uptake ABC transporter family permease subunit -
  JD965_RS01955 (JD965_01955) - 386718..387476 (+) 759 WP_198698366.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4214.93 Da        Isoelectric Point: 8.0284

>NTDB_id=518478 JD965_RS01930 WP_016937261.1 382599..382718(+) (phrC) [Bacillus siamensis strain B28]
MKLKSKWFVICLAAAAIFTVAGAGQTDQADFHVTERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=518478 JD965_RS01930 WP_016937261.1 382599..382718(+) (phrC) [Bacillus siamensis strain B28]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTTGCAGGTGCAGGCCAGACAGA
TCAGGCTGACTTCCATGTAACTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

77.5

100

0.795